SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000020293 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000020293
Domain Number 1 Region: 27-87
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.7e-27
Family KRAB domain (Kruppel-associated box) 0.00091
Further Details:      
 
Domain Number 2 Region: 609-665
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.46e-25
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 3 Region: 384-441
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.18e-24
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 4 Region: 552-609
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.6e-24
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 5 Region: 440-497
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.38e-23
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 6 Region: 496-553
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.13e-22
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 7 Region: 692-749
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.38e-21
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 8 Region: 749-797
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.2e-19
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 
Domain Number 9 Region: 346-398
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2e-18
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 
Domain Number 10 Region: 655-687
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000504
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000020293
Domain Number - Region: 266-313
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00121
Family Classic zinc finger, C2H2 0.047
Further Details:      
 
Domain Number - Region: 159-198
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0597
Family Classic zinc finger, C2H2 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000020293   Gene: ENSMMUG00000010528   Transcript: ENSMMUT00000021694
Sequence length 797
Comment pep:known_by_projection chromosome:MMUL_1:9:37063715:37109967:1 gene:ENSMMUG00000010528 transcript:ENSMMUT00000021694 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKRAVSSELSPSFQEQNKMNKVEQKFQGSVSFEDVTVGFSQEEWQHLDPSQRALYRDVM
LENYSNLVSVGYCVYKPEVIFRLEQGEEPWRLEEEFPSQSFPEVWTADHLKERSQENLSK
HLWEIVFINDEMLTKEQGNVIGIPFNVDVSSFPSRKMFCQCDSCGMSFNTVSQLVISKMN
YLGKKSDEFNAFGKLVLNIKHDETYTREKNEVLKNRNTLSHHENTLQHEKIQTLEHNFEY
SVCREALLEKAVFNTRKRENAEENNCEYNEFGRTFCDGSSLLFHQIPPSKDNHYEFSDCK
KFLCVKSTLSKHHGVPMKHYDCGESGNNFRRKLCLSQLQKGDKGEKHFECNECGKAFWEK
SHLTRHQRVHTGEKRFQCNECGKMFWEKSNLTKHQRSHTGEKPFECNECGKAFSHKSALT
LHQRTHTGEKPYQCNACEKTFYQKSDLTKHQRTHTGLKPYECYECGKSFCMNSHLMVHQR
THTGEKPFECLECGKSFCQKSHLTQHQRTHIGDKPYECNACGKTFYHKSVLTRHQIIHTG
LKPYECYECGKTFCLKSDLTVHQRTHTGEKPFACPECGKFFSHKSTLSQHYRTHTGEKPY
ECHECGKIFYNKSYLTKHNRTHTGEKPYECNECGKTFCQKSQLTQHQRIHIGEKPYECNE
CGKAFCHKSALIVHQRTHTQEKPYKCNECGKSFCVKSGLILHERKHTGEKPYECSECGKS
FSHKSSLTVHHRAHTGEKSCQCNECGKIFYRKSDLAKHQRSHTGEKPYECNTCRKTFSQK
SNLIVHQRTHIGEKPYE
Download sequence
Identical sequences ENSMMUP00000020293 ENSMMUP00000013797 9544.ENSMMUP00000020293

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]