SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000020405 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000020405
Domain Number 1 Region: 80-130
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000159
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Domain Number 2 Region: 495-540
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000992
Family Classic zinc finger, C2H2 0.0024
Further Details:      
 
Domain Number 3 Region: 726-781
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000139
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 4 Region: 544-571
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000321
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 5 Region: 634-662
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000104
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 6 Region: 789-813
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000411
Family Classic zinc finger, C2H2 0.036
Further Details:      
 
Domain Number 7 Region: 588-624
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000439
Family Classic zinc finger, C2H2 0.058
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000020405
Domain Number - Region: 138-169
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00563
Family Classic zinc finger, C2H2 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000020405   Gene: ENSMMUG00000015556   Transcript: ENSMMUT00000021816
Sequence length 897
Comment pep:known_by_projection chromosome:MMUL_1:10:378077:387196:1 gene:ENSMMUG00000015556 transcript:ENSMMUT00000021816 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDPFCVGGRRPPGSSKSGPGKDGSRKEVRLPMLHDPPKMGMPVVRGGQTVPGQAPLCFD
PGSPASDKTEGKKKGRPKAENQALRDIPLSLMNDWKDEFKAHSRVKCPNSGCWLEFPSIY
GLKYHYQRCQGGAISDRLAFPCPFCEAAFTSKTQLEKHRIWNHMDRPLPASKPGPINRPV
TISRPVGVSKPIGVSKPVTIGKPVGVSKPIGISKPVSVGRPMPVTKAMPVTRPVPVTKPV
TVSRPMPVTKAMPVTRPVPVTKPITVTKSVPVTKPVPVTKPITVTKLVTVTKPVPVTKPV
TVSRPIVVSKPVTVSRPIAISRHTPPCKMVLLTKSENKAPRATGRNSGKKRAADGLDTCP
IPPKQARPENGEYGPSTMGQSSAFQLSADASSGSLSPGSRPSGGVEALRAAGPASPPEED
PERTKHRRKQKTPKKFTGEQPSISGTFGLKGLVKAEDKARVHRSKKQEGPGPEDARKKVP
APITVSKEAPAPMAHPAPGGPEEQWQRAIHERGEAVCPTCNVVTRKTLVGLKKHMEVCQK
LQDALKCQHCRKQFKSKAGLNYHTMAEHSAKPSDAEASEGGEQEERERLRKVLKQMGRLR
CPQEGCGAAFSSLMGYQYHQRRCGKPPCEVDSPSFPCTHCGKTYRSKAGHDYHVRSEHTA
PPPEEPTDKSPEAEDLLGVERTPSGRVRRTSAQVAVFHLQEIAEDELARDWTKRRMKDDL
VPETARLNYTRPGLPTLNPQLLEAWKNEVKEKGHVNCPNDCCEAIYSSVSGLKAHLASCS
KGAHLAGKYHCLLCPKEFSSESGVKYHILKTHAENWFRTSADPPPKHRSQDSLVPKKEKK
KNLAGGKKRGRKPKERPPEEPVAKLPPRRDDWPLGCKDKGARGSTGRKVGASKAPEK
Download sequence
Identical sequences XP_015004039.1.72884 XP_015004040.1.72884 ENSMMUP00000020405 9544.ENSMMUP00000020405 ENSMMUP00000020405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]