SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000020763 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000020763
Domain Number 1 Region: 351-615
Classification Level Classification E-value
Superfamily Kelch motif 5.49e-76
Family Kelch motif 0.00000143
Further Details:      
 
Domain Number 2 Region: 71-187
Classification Level Classification E-value
Superfamily POZ domain 2.25e-33
Family BTB/POZ domain 0.00041
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000020763
Domain Number - Region: 27-36
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0217
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000020763   Gene: ENSMMUG00000015802   Transcript: ENSMMUT00000022193
Sequence length 636
Comment pep:known_by_projection chromosome:MMUL_1:1:4031821:4036274:1 gene:ENSMMUG00000015802 transcript:ENSMMUT00000022193 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPRSERPAGRTQSPEHGSPGPGPEAPPPPPPPQPPAPEAERTRPRQARPAAPMEGAVQL
LSREGHSVAHNSKRHYHDAFVAMSRMRQRGLLCDIVLHVAAKEIRAHKVVLASCSPYFHA
MFTQMSESRQTHVTLHDIDPQALDQLVQFAYTAEIVVGEGNVQTLLPAASLLQLNGVRDA
CCKFLLSQLDPSNCLGIRGFADAHSCSDLLKAAHRYVLQHFVDVAKTEEFMLLPLKQVLE
LVSSDSLNVPSEEEVYRAVLSWVKHDVDARRQHVPRVRPGPGGSHSIQEGMQVAEGLVRP
DPEFRDSVGMVPTLSEEKPVTQVVQASGGLSQPWGPVCLRVPPERSVPCAPAHEAYDTRT
DRWHVVASMSTRRARVGVAAVGNRLYAVGGYDGTSDLATVESYDPVTNTWQPEVSMGTRR
SCLGVAALHGLLYSAGGYDGASCLNSAERYDPLTGTWTSVAAMSTRRRYVRVATLDGNLY
AVGGYDSSSHLATVEKYEPQVNAWSSVASMLSRRSSAGVAVLEGALYVAGGNDGTSCLNS
VERYSPKAGAWESVAPMNIRRSTHDLVAMDGWLYAVGGNDGSSSLNSIEKYNPRTNKWVA
ASCMFTRRSSVGVAVLELLNFPPPSSPTLSVSSTSL
Download sequence
Identical sequences ENSMMUP00000020763 9544.ENSMMUP00000020763 ENSMMUP00000020763

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]