SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000020805 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000020805
Domain Number 1 Region: 1152-1307,1347-1426
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.1e-35
Family Voltage-gated potassium channels 0.02
Further Details:      
 
Domain Number 2 Region: 1477-1727
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.18e-35
Family Voltage-gated potassium channels 0.016
Further Details:      
 
Domain Number 3 Region: 665-894
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.26e-29
Family Voltage-gated potassium channels 0.015
Further Details:      
 
Domain Number 4 Region: 129-271,335-405
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.65e-29
Family Voltage-gated potassium channels 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000020805   Gene: ENSMMUG00000015827   Transcript: ENSMMUT00000022236
Sequence length 1957
Comment pep:known_by_projection chromosome:MMUL_1:2:97738291:97838309:1 gene:ENSMMUG00000015827 transcript:ENSMMUT00000022236 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEFPIGSLGTNNFRRFTPESLVEIEKQIAAKQAAKKAREKHREQKDQEEKTRPQLDLKAC
NQLPKFYGELPAELIGEPLEDLDTFYSTHRTFMVLNKGRTISRFSATRALWLFSPFNLIR
RTAIKVSTHWWFSLFITVTILVNCVCMTRTDLPEKIEYVFTVIYTFEALIKILARGFCLN
EFTYLRDPWNWLDFSVITLAYVGTAIDLRGISGLRTFRVLRALKTVSVIPGLKVIVGALI
NSVKKLADVTILTIFCLSVFALVGLQLFKGNLKNKCVKNDMAVNETTNYSSHRKPDIYIN
KRGTSDPLLCGNGSDSGHCPDGYICLKTSDNPDFNYTSFDSFAWAFLSLFRLMTQDSWER
LYQQTLRASGKIYMIFFVLVIFLGSFYLVNLILAVVTMAYEEQNKATIDEIEAKEKLFQE
TLEKLRKEQEVLAALGIDTTSLHSHNGSPLTSKNASERRHRIKSRVSEGSTEDNKSPRSD
PYNQRRMSFLGLASGKRRASHGSVFHFRSPGRDISLPEVVTDDGVFPGDHESHRGSLLLG
GSAGQQGPLPRSPLPQPSNPDSRHGEDEHPLPPTSELAPGAVEVSAFDAGQKKTFLSAEY
LDEPFRAQRAMSVVSIITSVLEELEESEQKCPPCLTSLAQKYLIWDCCPMWVKLKTILFG
LVTDPFAELTITLCIVVNTIFMAMEHHGMSPTFEAMLQIGNIVFTIFFTAEMVFKIIAFD
PYYYFQKKWNIFDCIIVTVSLLELGVAKKGSLSVLRSFRLLRVFKLAKSWPTLNTLIKII
GNSVGALGNLTIILAIIVFVFALVGKQLLGENYRNNRKNISAPHEDWPRWHMHDFFHSFL
IVFRILCGEWIENMWACMEVGQKSICLILFLTVMVLGNLVVLNLFIALLLNSFSADNLTA
LEDDGEVNNLQVALARIQVFGHRIKQVLCSFFSRPCPFPRPKAEPELVVKLPLSSSKAEN
HIAANTAEGSSGGLQAPRGPRDEHSDFIANPTVWVSVPIAEGESDLDDLEDDGEEDAQSA
QQEVIPKGQSEFPRQANREENSSVPGLSWRGTKHGDRVQFPGPRGETSSLPWASPLQGVD
DTSSSEGSTVDCPDPEEILRKIPELADDLEEPDDCFTEGCIRHCPCCKVDTTKSPWDMGW
QVRKTCYRIVEHSWFESFIIFMILLSSGSLAFEDYYLDQKPTVKALLEYTDRVFTFIFVF
EMLLKWVAYGFKKYFTNAWCWLDFLIVNISLTSLTAKILEYSEVAPIKALRTLRALRPLR
ALSRFEGMRVVVDALVGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFWRCINYTDGEFS
LVPLSIVNNKSDCKIQNSTGSFFWVNVKVNFDNVAMGYLALLQVATFKGWMDIMYAAVDS
REVNMQPKWEDNVYMYLYFVIFIIFGGFFTLNLFVGVIIDNFNQQKKKIRGQDIFMTEEQ
KKYYNAMKKLGSKKPQKPIPRPLNKFQGFVFDIVTRQAFDITIMVLICLNMITMMVETDD
QSEEKTKILGKINQFFVAVFTGECVMKMFALRQYYFTNGWNVFDFIVVVLSISSLVFSAI
LKSLQNYFSPTLFRVIRLARIGRILRLIRAAKGIRTLLFALMMSLPALFNIGLLLFLVMF
IYSIFGMSSFPHVRWEAGIDDMFNFQTFANSMLCLFQITTSAGWDGLLSPILNTGPPYCD
PNLPNSNGTRGDCGSPAVGIIFFTTYIIISFLIVVNMYIAVILENFNVATEESTEPLSED
DFDMFYETWEKFDPEATQFITFSALSDFADTLSGPLRIPKPNRNILIQMDLPLVPGDKIH
CLDILFAFTKNVLGESGELDSLKANMEEKFMATNLSKSSYEPIATTLRWKQEDISATVIQ
KAYRSYVLHRSMALSNTLHVPRAEEEAASLPDEAFVAFTANENCVLPDKSETASATSFPP
SYESVTRGLSDRVNMRTSSSIQNEDEATSTEVTAPGP
Download sequence
Identical sequences ENSMMUP00000020805 9544.ENSMMUP00000020805 ENSMMUP00000020805

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]