SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000021020 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000021020
Domain Number 1 Region: 355-412
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.82e-25
Family Classic zinc finger, C2H2 0.003
Further Details:      
 
Domain Number 2 Region: 467-524
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.01e-25
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 3 Region: 299-356
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.46e-25
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 4 Region: 411-468
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.65e-23
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 5 Region: 3-54
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.57e-22
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 6 Region: 257-309
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.81e-19
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 7 Region: 509-561
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000506
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000021020
Domain Number - Region: 175-219
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0285
Family Classic zinc finger, C2H2 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000021020   Gene: ENSMMUG00000015981   Transcript: ENSMMUT00000022470
Sequence length 579
Comment pep:known chromosome:MMUL_1:19:59333239:59343726:-1 gene:ENSMMUG00000015981 transcript:ENSMMUT00000022470 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VFLFQGLFTFKDVAIEFSQEEWEYLDPAQRALYRDVMLENYRNLLSLDEDNVLPENDISV
GFTSKGLSPKENNKEELYHLVILERKESHGINNFDLKEVWENMSKFDSLWDYDAKNYKGT
PLTSNKNLTPRKDQQHNKSSIHFSLKQSVSIRDSAYQYFIHDMPFIRNLLKLKNNIRYVG
NKYVKCFENRIGLSLQAQLTERQRFQTGEKMYECNPVEKSINSSSVSPLPPCVKNICNKY
RKILKYPLLHTQYGRTHIREKSYKCNDCGKAFSKSSNLTNHQRIHSGQRPYQCKECGKAF
NQCSNLTRHQRVHTGEKPYQCNICGKVCSQNSNLASHQRMHTGEKPYKCNECGKAFIQRS
HLWGHERIHTGEKPYKCSECDKAFAERSSLTQHKRIHTGEKPYICNECGKAFKQCSHLTR
HQNIHPGEKPHKCHVCGKAFIQSSSLVEHQRIHTGEKPYKCNKCDKAFIKRSHLWGHQRT
HTGEKPYKCTECGKAFTERSNLTQHKKIHTGEKPYKCTECGKAFTQFANLTRHQKIHIEK
KHCKHNIHGNALFQSSNLGDHQKIYNTEKCIKYNEIKIK
Download sequence
Identical sequences 9544.ENSMMUP00000021020 ENSMMUP00000021020 ENSMMUP00000021020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]