SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000021141 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000021141
Domain Number 1 Region: 360-417
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.82e-24
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 2 Region: 640-697
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.06e-23
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 3 Region: 416-473
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.67e-23
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 4 Region: 472-529
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.89e-22
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 5 Region: 304-361
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.39e-21
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 6 Region: 682-734
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.88e-21
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 7 Region: 585-641
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.33e-20
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 8 Region: 528-585
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.25e-20
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 9 Region: 249-305
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.55e-18
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 10 Region: 3-49
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.15e-16
Family KRAB domain (Kruppel-associated box) 0.0023
Further Details:      
 
Domain Number 11 Region: 193-249
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000321
Family Classic zinc finger, C2H2 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000021141   Gene: ENSMMUG00000016066   Transcript: ENSMMUT00000022598
Sequence length 743
Comment pep:novel chromosome:MMUL_1:19:59395886:59399478:1 gene:ENSMMUG00000016066 transcript:ENSMMUT00000022598 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFSFHGRLTFRDVAIEFSLAEWKCLDPVQRALYTAVMLENYRNLEFVDKNRKFMNTLTNT
IEHHPAVGRDVLGSPEQNCQRGPGYEIESMTLTDKCFQLCSSDCYRKFLLEIKKDIHHSE
FQWQEVERNGHEAPMTETREMTRSTDRYDHSHAGNKPIKDQLGSSFHSHLPELHIFPTEG
KISNQVDKYGKNFLYSSLSTQIQEVRMREKPCRYNECGKAFNYSSLLRSHHITHSREKQY
KCDVCGKIFNQKRYLACHRRCHTGKKTYKCNECGKVFSQTSSFTCHCRLHSGQKPYKCNE
CGKTFSWKSSLRCHRRLHTGEKPYKCNECGKTFHQKTSLQCHHTVHTGEKAYKCYECGKT
FSQMSSLTCHRRLHTGEKPYKCNECGKTFSRKSSLICHCRLHTGEKPYKCNECGKTFIRK
SSLICHCRLHTGEKPYKCNECGKTFSQKTTLTCHRRLHTGEKPYKCNECGKTFSEKSSLR
CHCRLHTGEKPYKCNECGKTFRRNSGLVIHKAVHSEEKPYKCNECGKTFRQKSYLQCHHR
LHTGEKLYTCNECGKVFSRRQNFAHHHRLHTGEKPYKCEECDKVYIRRSQLETHRIIHTG
ERSYKCKVCDKAFWKKSCLVHHKRVHTGEKPYKCNKCGKTFSQKSNLQCHHTLHTGEKPY
TCNECGKAFRSDSCLAQHQRVHTGEKPYKCNECGKVFNQKAHLAQHQRVHTGEKPYKCNE
CDRAFSGKSTLIHHQAIHGVGKL
Download sequence
Identical sequences ENSMMUP00000021141 ENSMMUP00000021138 9544.ENSMMUP00000021141

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]