SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000021459 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMMUP00000021459
Domain Number - Region: 532-573
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0558
Family EGF-type module 0.097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000021459   Gene: ENSMMUG00000016339   Transcript: ENSMMUT00000022944
Sequence length 686
Comment pep:known chromosome:MMUL_1:15:41676310:41693968:-1 gene:ENSMMUG00000016339 transcript:ENSMMUT00000022944 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SAARSRPGLNSHPDPRPPLRAREDTGGHPPGVGSGAAAPPRLKSGFQLPPALLLLLLFSV
LGPGAGGLFLTDYSTCSPRKLSPFRSFASTELFHFHVPEDTFLAVWNLIIFKEQGGTFGD
HCPDQSVTVYFRSGAPPVINPLHTHFPGDTAVPGVFSLTLSWTLPNRTSGIFNVSSPLPG
DWFLAAHLPQAHGHISVKGLQDECQYLLQPQLIVRRLLDVAVLVPGRPSEQTLSPHNRSA
LYKVFVPSFTYRVSAQLACVGGRGVSACPLSLRLRPKAPPLHNSSSVSCGGASGCQLELA
LPPWGHWVYVRVETSSRGPGRTIRFQLCVRLQECPQPGLLRALVPGAAMNMPQSLGNQPL
PPEPPSLGTPAEGPGTTSPPEHCWPVRPTLRNELDTFSVHFYIFFGPSVALPPERPAVFA
MRLLPVLDSGGVLSLELQLNASSVRQENVTVFGCLTHEVPLSLGDAAVTCSKESLAGFLL
SVSATTRVARLRIPFPQTGTWFLALRSLCGVGPRFVRCRNATAEVRMRTFLSPCVDDCGP
YGQCKLLRTHNYLYAACECKAGWRGWGCTDSADALTYGFQLLSTLLLCLSNLMFLPPVVL
AIRSRYVLEAAVYTFTMFFSTVCGCVCILSLGACEWWWVTVCISTTFSKGLGMYVPSLCL
LQTETAVLPNLSCIEKGRFCKAHWRK
Download sequence
Identical sequences 9544.ENSMMUP00000021459 ENSMMUP00000021459 ENSMMUP00000021459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]