SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000021964 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000021964
Domain Number 1 Region: 146-273
Classification Level Classification E-value
Superfamily PUG domain-like 1.83e-30
Family PUG domain 0.003
Further Details:      
 
Domain Number 2 Region: 307-408
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.5e-17
Family UBX domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000021964   Gene: ENSMMUG00000016709   Transcript: ENSMMUT00000023475
Sequence length 441
Comment pep:known chromosome:MMUL_1:19:4312569:4325644:-1 gene:ENSMMUG00000016709 transcript:ENSMMUT00000023475 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKFFQEFKADIKFKSAGPGQKLTESVGEKAPKQKSSQPAPRPPRQGPTNEAQMAAAAAL
ARLEQKQSRAWGPTSQDSIRNQVRKELQAEATVSGSPEAPGTNVVSEPREEGSAHLAVPG
VYFTCPLTGATLRKDQRDARIKEAILSHFSTDPVAASIMKIHTFNKDRDRVKLGVDTIAK
YLDNIHLHPEEEKYRKIKLQNKVFQERINCLEGTHEFFEAIGFQKVLLPIQDQEDPEEFY
VLSETTLAQPQSLERHKEQLLAAEPVRAKLDRQRRVFQPSPLASQFELPGDFFNLTAEEI
KREQRLRSDAVERLSVLRTKAMREKEEQRGLRKYTYTLLRVRLPDGCLLQGTFYARERLG
AVYGFVREALQSDWLPFELLASGGQKLSEDENLALNECGLVPSALLTFSWDMAVLEDIKA
AGVEPDAILKPELLSAIEKLS
Download sequence
Identical sequences F6VEF6
NP_001245098.1.72884 9544.ENSMMUP00000021964 ENSMMUP00000021965 ENSPANP00000009099 ENSMMUP00000021964

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]