SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000021980 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000021980
Domain Number 1 Region: 44-131
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 7.32e-37
Family SCAN domain 0.0000545
Further Details:      
 
Domain Number 2 Region: 461-517
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.63e-26
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 3 Region: 657-713
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.13e-25
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 4 Region: 405-461
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.71e-25
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 5 Region: 600-657
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.05e-25
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 6 Region: 544-601
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.29e-23
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 7 Region: 702-754
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.12e-19
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 8 Region: 165-224
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.54e-19
Family KRAB domain (Kruppel-associated box) 0.002
Further Details:      
 
Domain Number 9 Region: 348-405
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.03e-17
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number 10 Region: 507-539
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000234
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000021980   Gene: ENSMMUG00000016723   Transcript: ENSMMUT00000023493
Sequence length 761
Comment pep:known chromosome:MMUL_1:16:15880884:15898402:1 gene:ENSMMUG00000016723 transcript:ENSMMUT00000023493 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLASSKRMNNSSRSQILLRWKSDKAQSGPYNVEKEILTSRFLRDTETCRQNFRNFPYPDL
AGPRKALSQLRELCLKWLRPEIHSKEQILELLVLEQFLTILPGEVRTWVKSQYPESSEEA
VTLVEDLTQILEEEAPQNSTLSQDTPEEDPRGKHAFQAGWLNDLVTKESMTFKDVAVDIT
QEDWELMRPVQKELYKTVTLQNYWNMVSLGLTVYRPTVIPMLEEPWMVIKEILEGPSPEW
ETKVQACTPVENMSKLTKEETQTIKLEDSYDYNDRLQRRATGGFWKFHTNERGFSLKSVL
SQEDDPTEECLSKYDIYRNNFEKHSNLIVQFDTQLDNKTSVYNEGRATFNHVSYGIVHRK
ILPGEKPYKCNVCGKKFRKYPSLLKHQSTHAKEKSYECEECGKEFRHISSLIAHQRMHTG
EKPYECHQCGKAFSQRAHLTIHQRIHTGEKPYKCDDCGKDFSQRAHLTIHQRTHTGEKPY
KCLECGKTFSHSSSLINHQRVHTGEKPYICNECGKTFSQSTHLLQHQKIHTGKKPYKCNE
CWKVFSQSTYLIRHQRIHSGEKCYKCNECGKAFAHSSTLIQHQTTHTGEKSYICNICGKA
FSQSANLTQHHRTHTGEKPYKCSVCGKAFSQSVHLTQHQRIHNGEKPFKCNICGKAYRQG
ANLTQHQRIHTGEKPYKCNECGKAFIYSSSLNQHQRTHTGERPYKCNECDKDFSQRTCLI
QHQRIHTGEKPYACRTCGKTFTQSTNLIQHQRVHTGAKHRN
Download sequence
Identical sequences A0A2K5WNI8 A0A2K6C3Z4 F6VCW6
ENSMMUP00000021980 NP_001253638.1.72884 XP_005583025.1.63531 XP_011716679.1.29376 XP_011716680.1.29376 XP_011716681.1.29376 XP_014974148.1.72884 ENSMMUP00000021980 9544.ENSMMUP00000021980

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]