SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000022149 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000022149
Domain Number 1 Region: 278-328
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000022
Family Classic zinc finger, C2H2 0.0067
Further Details:      
 
Domain Number 2 Region: 211-263
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000154
Family Classic zinc finger, C2H2 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000022149   Gene: ENSMMUG00000016845   Transcript: ENSMMUT00000023670
Sequence length 430
Comment pep:known chromosome:MMUL_1:12:7891774:8052242:-1 gene:ENSMMUG00000016845 transcript:ENSMMUT00000023670 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKQPIMADGPRCKRRKQANPRRKNVVNYDNVVDTGSETDEEDKLHIAEDDGIANPLDQET
SPASVPNHESSPHVSQALLPREEEEDEIREGGVEHPWHNSEILQASVDGPEEMKEDYDTM
GPEATIQTTINNGTVKNANCTSDFEEYFAKRKLEERDGHAVSIEEYLQRSDTAIIYPEAP
EELSRLGTPEANGQEENDLPPGTPDAFAQLLTCPYCDRGYKRLTSLKEHIKYRHEKNEEN
FSCPLCSYTFAYRTQLERHMVTHKPGTDQHQMLTQGAGNRKFKCTECGKAFKYKHHLKEH
LRIHSGEKPYECPNCKKRFSHSGSYSSHISSKKCIGLISVNGRMRNNIKTGSSPNSVSSS
PTNSAITQLRNKLENGKPLSISRRSCSLMKTYRARWLKPVIPALWEAETGGSQGQEIETI
LANPVKPRLY
Download sequence
Identical sequences ENSMMUP00000022149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]