SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000022242 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000022242
Domain Number 1 Region: 209-266
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.15e-26
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 2 Region: 265-322
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.6e-25
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 3 Region: 433-490
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.68e-25
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 4 Region: 490-546
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.06e-24
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 5 Region: 2-58
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.66e-24
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 
Domain Number 6 Region: 321-378
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.93e-24
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 7 Region: 377-434
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.39e-23
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 8 Region: 531-583
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.44e-22
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 9 Region: 167-219
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.97e-16
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 10 Region: 137-182
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000526
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000022242   Gene: ENSMMUG00000003645   Transcript: ENSMMUT00000023765
Sequence length 594
Comment pep:known_by_projection chromosome:MMUL_1:19:20186684:20192752:1 gene:ENSMMUG00000003645 transcript:ENSMMUT00000023765 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GPLTFRDVAIEFSLKEWQCLDTAQRNLYRNVMLENYRNLVFLGIAVSKPDLITCLEQGKE
AWSMKRHEIMVAKSPVMCSHFAQDLWPEQNIKDSFQKATLKRYGTCRHENLPLRKGCESV
DECKMHKGGYNGLNQCLTATQSKIFQCDKYVKVIHKFSNSNRHRIRHTKKKPFKCRDCGK
SFRMISCLTQHSRIHTRVNSYKCEECGKTFNWSSTLTKHKRIHTGEKPYKCEECGKAFNQ
SSNLIKHKKIHTGEKPYKCEECGKAFNRSSTLTTHKIIHTGEKPYKCKECGKAFNRSSTL
TSHRKIHTGEKPYKCEECGKAFKQSSNLTTHKIIHTGEKPYKCKKCGKAFNQSAHLTTHK
IIHTGEKPYKCEKCGKAFNHFSHLTTHKIIHTAEKPYKCKECGKAFKHSSTLTKHKIIHT
GEKPYKCKECGKAFNQSSKLTEHKKIHTGEKPYECEKCGKAFNQSSNLTRHKKIHTEEKP
YKCEECGKGFKWPSTLTIHKVIHTGEKPYKCEECGKAFNQSSKLTKHKKIHTGEKPYTCE
ECGKAFNQSSNLTKHKRIHTGEKPYKCEECDKAFKWSSVLTKHKIIHTGEKLQM
Download sequence
Identical sequences 9544.ENSMMUP00000022242 ENSMMUP00000031712 ENSMMUP00000022242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]