SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000022460 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000022460
Domain Number 1 Region: 325-381
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.22e-22
Family Classic zinc finger, C2H2 0.0028
Further Details:      
 
Domain Number 2 Region: 2-62
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 7.06e-20
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 3 Region: 213-269
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.44e-19
Family Classic zinc finger, C2H2 0.0097
Further Details:      
 
Domain Number 4 Region: 380-435
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.34e-18
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 5 Region: 254-306
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.4e-17
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 6 Region: 156-213
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.43e-16
Family Classic zinc finger, C2H2 0.009
Further Details:      
 
Domain Number 7 Region: 425-477
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000121
Family Classic zinc finger, C2H2 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000022460   Gene: ENSMMUG00000021469   Transcript: ENSMMUT00000023995
Sequence length 488
Comment pep:known chromosome:MMUL_1:19:50489793:50501645:1 gene:ENSMMUG00000021469 transcript:ENSMMUT00000023995 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTSKEAVTFKDVVVVFTEEELGLLDLAQRKLYRDVMLENFRNLLSVGHQPFHRDTFHFL
REEKFWMMDIATQREGNSGGKIQPEMKTVPEAGPHEGLSCQQIWEEIASDLTRPQDSTTN
SSQFFEQGDAHSQVEEGLSIMHTGQKPSNHGKCKPSFSDVSIFDLPQQIHSAEKSHSRDE
CGKSFCYISALHIHQRVHLGEKLFKCDVCGKEFSQSLHLQTHQRVHTGEKPFKCEQCGRG
FRCRSALTVHCKLHMGEKHYNCEACGRAFIHDIQLQKHQRIHTGEKPFKCEICSMSFRLR
SSLNRHCVVHTGKKPNNTGEYGKGFIGRLDLCKHQTIHTGEKPYNCKECGKSFRRSSYLL
IHQRVHTGEKPYKCDKCGKSYITKSGLDLHHRAHTGERPYNCDDCGKSFRQASSILNHKR
LHCQKKPFKCEDCGKKLVHRSYRKKLVHRSDQPRDHSGENPSKCEDCGKRYKRRLNLDII
LSLFLNDT
Download sequence
Identical sequences 9544.ENSMMUP00000022460 ENSMMUP00000022460 ENSMMUP00000022460

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]