SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000022472 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000022472
Domain Number 1 Region: 2-63
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 9.68e-27
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 2 Region: 391-448
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.57e-25
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 3 Region: 335-392
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3e-24
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 4 Region: 279-336
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.44e-22
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 5 Region: 448-504
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.16e-21
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 6 Region: 493-545
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.56e-19
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 7 Region: 224-280
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000383
Family Classic zinc finger, C2H2 0.02
Further Details:      
 
Domain Number 8 Region: 125-180
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000257
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 9 Region: 184-220
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000827
Family Classic zinc finger, C2H2 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000022472   Gene: ENSMMUG00000017077   Transcript: ENSMMUT00000024012
Sequence length 561
Comment pep:known_by_projection chromosome:MMUL_1:9:38207229:38211301:1 gene:ENSMMUG00000017077 transcript:ENSMMUT00000024012 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VIFQGSVSFRDVTVGFTQEEWQHLDPAQRTLYRDVMLENYSHLVSVGYCIPKPEVILKLE
KGEEPWILEEKFPSQRHLELINTSRNYSRMKFNEFNKGGKCLCDEKHEIIHSEEEPYEYN
KNGNSFWLNEDLIWHQKIKNWEQPFEYNECGKAFPENSFFLVHKRGYTGQKTCKYTEHGK
TSDMSFFITHQQTHPRENHYECNQCGENIFEKSILLEHQSVYPFSQKLNLTPIQRTHSIN
NIIEYNECGTFFSEKLVLHLQQRTHTGEKPYECHECGKTFTQKSAHTRHQRTHTGGKHYE
CHECGKTFYKNSDLIKHQRIHTGERPYRCHECGKSFSEKSTLTQHQRTHTGEKPYECHEC
GKTFSFKSVLTVHQKTHTGEKPYECYACGKAFLRKSDLIKHQRIHTGEKPYECNKCGKSF
SEKSTLTKHLRTHTGEKPYECIQCGKFFCYYSGFTEHLRRHTGEKPFGCNECGKTFRQKS
ALIVHQRTHIRQKPYGCNECGKSFCVKSKLIAHHRTHTGEKPYECNVCGKSFYVKSKLTV
HQRTHLGRNPINVVSEGNYSG
Download sequence
Identical sequences ENSMMUP00000022472 9544.ENSMMUP00000022472 ENSMMUP00000022472

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]