SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000022581 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000022581
Domain Number 1 Region: 179-327
Classification Level Classification E-value
Superfamily PH domain-like 1.38e-29
Family Third domain of FERM 0.0019
Further Details:      
 
Domain Number 2 Region: 69-178
Classification Level Classification E-value
Superfamily Second domain of FERM 1.02e-23
Family Second domain of FERM 0.0017
Further Details:      
 
Domain Number 3 Region: 2-69
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.48e-16
Family First domain of FERM 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000022581   Gene: ENSMMUG00000017164   Transcript: ENSMMUT00000024134
Sequence length 1004
Comment pep:known_by_projection chromosome:MMUL_1:9:13916430:14083735:-1 gene:ENSMMUG00000017164 transcript:ENSMMUT00000024134 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQPKLLAKELLDLVASHFNLKEKEYFGIAFTDETGHLNWLQLDRRVLEHDFPKKSGPVVL
YFCVRFYIESISYLKDNATIELFFLNAKSCIYKELIDVDSEVVFELASYILQEAKGDFSS
NEVVRSDLKKLPALPTQALKEHPSLAYCEDRVIEHYKKLNGQTRGQAIVNYMSIVESLPT
YGVHYYAVKDKQGIPWWLGLSYKGIFQYDYHDKVKPRKIFQWRQLENLYFREKFSVEVHD
PRRASVTRRTFGHSGIAVHTWYACPALIKSIWAMAISQHQFYLDRKQSKSKIHAARSLSE
IAIDLTETGTLKTSKLANMGSKGKIISGSSGSLLSSGSQESDSSQSAKKDMLAALKSRQE
ALEETLRQRLEELKKLCLREAELTGKLPVEYPLDPGEEPPIVRRRIGTAFKLDEQKILPK
GEEAELERLEREFAIQSQITEAARRLASDPNVSKKLKKQRKTSYLNALKKLQEIENAINE
NRIKSGKKPTQRASLIIDDGNIASEDSSLSDALVLEDEDCQVTSTISPLHSPHKGLPPRP
PSHNRPPPPQSLEGLRQTHCHRSDYDRSPIKPKMWSESSLDEPYEKVKKRSSHSHSSSHK
RFPSTGSCAEAGGGSNSLQNSPIRGLPHWNSQSSMPSTPDLRVRSPHYVHSTRSVDISPT
RLHSLALHFRHRSSSLESQGKLLGSENDTGSPDFYTPRTRSSNGSDPMDDCSSCTSHSSS
EHYYPAQMNANYSTLAEDSPSKARQRQRQRQRAAGALGSASSGSMPNLAARGGAGGAGGA
GGGVYLHSQSQPSSQYRIKEYPLYIEGGATPVVVRSLESDQEGHYSVKAQFKTSNSYTAG
GLFKESWRGGGGGDEGDTGRLTPSRSQILRTPSLGREGAHDKGAGRAAVSDELRQWYQRS
TASHKEHSRLSHTSSTSSDSGSQYSTSSQSTFVAHSRVTRMPQMCKATSAALPQSQRSST
PSSEIGATPPSSPHHILTWQTGEATENSPILDGSESPPHQSTDE
Download sequence
Identical sequences ENSMMUP00000022581 ENSMMUP00000022580 9544.ENSMMUP00000022581

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]