SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000022609 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000022609
Domain Number 1 Region: 2-122
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.02e-41
Family Galectin (animal S-lectin) 0.000000577
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000022609   Gene: ENSMMUG00000017187   Transcript: ENSMMUT00000024164
Sequence length 123
Comment pep:known chromosome:MMUL_1:10:81594506:81596831:1 gene:ENSMMUG00000017187 transcript:ENSMMUT00000024164 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XPGECLRVRGEVAPYAKSFVLNLGKDSNNLCLHFNPRFNAHGDANTIVCNSKDGGAWGTE
QREAAFPFQPGSVAEVCITFDQADLTIKLPDGYEFKFPNRLNLEAINYMAADGDFKIKCV
AFD
Download sequence
Identical sequences ENSMMUP00000022609 9544.ENSMMUP00000022609 ENSMMUP00000022609

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]