SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000022616 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000022616
Domain Number 1 Region: 21-84
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.92e-24
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 2 Region: 226-283
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.88e-24
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 3 Region: 450-507
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.2e-23
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 4 Region: 562-619
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.06e-22
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 5 Region: 604-656
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.85e-21
Family Classic zinc finger, C2H2 0.0028
Further Details:      
 
Domain Number 6 Region: 506-563
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.67e-21
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 7 Region: 282-339
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.45e-21
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 8 Region: 171-227
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.35e-20
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 9 Region: 394-451
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.69e-20
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 10 Region: 339-395
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.2e-19
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 11 Region: 132-184
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000035
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000022616   Gene: ENSMMUG00000002495   Transcript: ENSMMUT00000024171
Sequence length 665
Comment pep:known chromosome:MMUL_1:19:44066817:44100935:-1 gene:ENSMMUG00000002495 transcript:ENSMMUT00000024171 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFLVLEPHRVGLIRSYSSKTMTCFQELVTFRDVAIDFSQQEWEYLDPNQRDLYRDVMLEN
YRNLVSLGGHSISKPVVVDLLEQGKEPWMILREETQFTDLDLQCEIISYIEVPTYETGIS
SVQLQSIYKREKLYECKKCQKKFSSGYQLILHHKFHIIERPYECKECGENFRSGYQLTLH
QRFHTGEKPYECTECGKDFKSGYQLTVHQRFHTGEKTYECRQCGKAFIYASHIAQHERIH
TGGKPYECQECGKAFSQGGHLRIHQRVHTGEKPYKCKECGKTFSRRSNLVEHGQIHTDEK
PYVCEKCGKAFRRCHQLTVHQSVHTGKKPYECKECGKGYTTASYFLLHQRIHKGGKPYEC
KECKKTFTLYRNLTRHQNIHTGEKLFECKQCGKTYTTGSKLFQHQKTHTGEKPYECKECG
KAFTLYGYLKQHQKIHTGMKHFECKECKKTFTLYRNLTRHQNIHTGKKLFECQECGKAYS
TGSNLIQHQKIHTGEKPYECKECGKTFSLHGYLNQHQKIHTGVKPYECKVCRKTFTFYRN
LTLHQSIHTDEKPFECKECGKTFRRTSHLTAHQSIHADKKPYECKECGKAFKMYGYLTQH
QKIHTGGKPYECKECGKAFSRASNLVQHERIHTGEKPYVCKQCGKTFRYGSALKAHQGIH
RSTKV
Download sequence
Identical sequences A0A2K6D0A2 F7HIL3
9544.ENSMMUP00000022616 ENSMMUP00000022616 XP_011763244.1.29376 XP_014979275.1.72884 ENSMMUP00000022616

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]