SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000022621 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000022621
Domain Number 1 Region: 186-411
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.45e-54
Family Voltage-gated potassium channels 0.00086
Further Details:      
 
Domain Number 2 Region: 15-129
Classification Level Classification E-value
Superfamily POZ domain 6.08e-33
Family Tetramerization domain of potassium channels 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000022621   Gene: ENSMMUG00000017198   Transcript: ENSMMUT00000024176
Sequence length 491
Comment pep:known chromosome:MMUL_1:13:17820267:17873280:1 gene:ENSMMUG00000017198 transcript:ENSMMUT00000024176 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVFGEFFHRPGQDEELVNLNVGGFKQSVDQSTLLRFPHTRLGKLLTCHSEEAILELCDDY
SVADKEYYFDRNPSLFRYVLNFYYTGKLHVMEELCVFSFCQEIEYWGINELFIDSCCSNR
YQERKEENHEKDWDQKSHDVSTDSSFEESSLFEKELEKFDTQRFGQLRKKIWIRMENPAH
CLSAKLIAISSLSVVLASIVAMCVHSMSEFQNEDGEVDDPVLEGVEIACIAWFTGELAVR
LAAAPCQKKFWKNPLNIIDFVSIIPFYATLAVDTKEEESEDIENMGKVVQILRLMRIFRI
LKLARHSVGLRSLGATLRHSYHEVGLLLLFLSVGISIFSVLIYSVEKDDHTSSLTSIPIC
WWWATISMTTVGYGDTHPVTLAGKLIASTCIICGILVVALPITIIFNKFSKYYQKQKDID
VDQCSEDVPEKCHELPYFNIRDIYAQRMHAFITSLSSVGIVVSDPDSTDASSIEDNEDIC
NTTSLENCTAK
Download sequence
Identical sequences A0A096NP34 A0A0D9S9T2 A0A2K5KZC2 A0A2K5XQM3 A0A2K6AT51 F7HGM9 G8F573
9544.ENSMMUP00000022621 ENSPANP00000014751 ENSMMUP00000022621 XP_001093222.1.72884 XP_005576548.1.63531 XP_005576549.1.63531 XP_005576550.1.63531 XP_007969581.1.81039 XP_007969582.1.81039 XP_011736523.1.29376 XP_011736524.1.29376 XP_011736525.1.29376 XP_011736526.1.29376 XP_011736527.1.29376 XP_011826815.1.47321 XP_011826816.1.47321 XP_011826817.1.47321 XP_011899917.1.92194 XP_011899918.1.92194 XP_011899919.1.92194 XP_014967245.1.72884 XP_014967247.1.72884 ENSMMUP00000022621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]