SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000022629 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000022629
Domain Number 1 Region: 855-913
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000641
Family TSP-1 type 1 repeat 0.003
Further Details:      
 
Domain Number 2 Region: 625-691
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000942
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 
Domain Number 3 Region: 49-105
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000157
Family TSP-1 type 1 repeat 0.0012
Further Details:      
 
Domain Number 4 Region: 746-800
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000249
Family TSP-1 type 1 repeat 0.0078
Further Details:      
 
Domain Number 5 Region: 800-860
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000392
Family TSP-1 type 1 repeat 0.0032
Further Details:      
 
Domain Number 6 Region: 568-628
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000196
Family TSP-1 type 1 repeat 0.0088
Further Details:      
 
Domain Number 7 Region: 693-743
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000719
Family TSP-1 type 1 repeat 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000022629   Gene: ENSMMUG00000017203   Transcript: ENSMMUT00000024184
Sequence length 957
Comment pep:known_by_projection chromosome:MMUL_1:15:4967094:5007184:-1 gene:ENSMMUG00000017203 transcript:ENSMMUT00000024184 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGRWQCSCWTWSLLVLAVVAGDTVSTGSTDNSPTSNSLEGDTDATAFWWGEWTKWTACS
RSCGGGVTSQERHCLKQRRKSAPGPGNRTCTGTSKRYQLCRVQECPPDGRSFREEQCVSF
NSHVYNGRTHQWKPLYPDDYVHISSKPCDLHCTTVDGQRQLMVPARDGTSCKLTDLRGVC
VSGKCEPIGCDGVLFSTHTLDKCGVCQGDGSSCTHVTGNYRKGNTHLGYSLVTHIPAGAR
DIQIVERKKSADVLALADEAGYYFFNGNYKVDSPKNFNIAGTVVKYRRPMDVYETGIEYI
VAQGPTNQGLNVMVWNQNGKSPSITFEYTLLQPPHEPHERRPQPVYYGFSEPASESAESQ
GLDGAGLMGFVPHNGSLYGQASSERLGLDNRLFGHPGLDMELGPSQGQETNEVCEQAGGG
ACEGPPRGKGFRDLNITGTPLAGDKDDQEVDTHFASQEFFSANAISDQLLGTGSDLKDFT
LNETVNSIFAQGAPRSSLAESFFVDYEENEGAGAYLLNGSYLELSSDRANSSAEAPFPNV
STSLPTSAGNRTHKARTRPKARKQGVSPADMYRWKLSSHEPCSATCTTGVMSTYAMCVRY
DGVEVDDSYCDALTRPEPVHEFCAGRECQPRWETSSWSECSRTCGEGYQFRVVRCWKMLS
PGFDSSVYSDLCEAAEAVRPEERKTCRNPACGPQWEMSEWSECTAKCGERSVVTRDIRCS
EDEKLCDPNTRPVGEKNCTGPPCDRQWTVSDWGPCSGSCGQGRTIRHVYCKTSDGRVVPE
SQCQMETKPLAIHPCGDKNCPAHWLAQDWERCNTTCGRGVKKRLVLCMELANGKPQTRSG
PECGLAKKPPEESTCFERPCFKWYTSPWSECTKTCGVGVRMRDVKCYQGTDIVRGCDPLV
KPVGRQACDLQPCPTEPPDDSCQDQPGTNCALAIKVNLCGHWYYSKACCRSCRPPHS
Download sequence
Identical sequences ENSMMUP00000022629 ENSMMUP00000040113 9544.ENSMMUP00000022629 ENSMMUP00000022629

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]