SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000022655 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000022655
Domain Number 1 Region: 31-79
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 6.93e-17
Family Ovomucoid domain III-like 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000022655   Gene: ENSMMUG00000017227   Transcript: ENSMMUT00000024211
Sequence length 79
Comment pep:known chromosome:MMUL_1:6:144269074:144276006:-1 gene:ENSMMUG00000017227 transcript:ENSMMUT00000024211 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVTGIFLLSALALLSLSGNTGADSLGREAKCYNELTGCTKIYDPVCGTDGKTYPNECVL
CFENQKRQTSVLIRKSGPC
Download sequence
Identical sequences A0A096NAT0 A0A2K5NJ41 A0A2K5ZTE8 A0A2K6D3G8 F7HE31 G7P8L5
XP_001102888.1.72884 XP_005558227.1.63531 XP_011714399.1.29376 XP_011834399.1.47321 XP_011924077.1.92194 ENSMMUP00000022655 9544.ENSMMUP00000022655 ENSMMUP00000022655 ENSPANP00000009824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]