SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000022695 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000022695
Domain Number 1 Region: 249-387,419-641
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 8.69e-72
Family Cellulases catalytic domain 0.075
Further Details:      
 
Domain Number 2 Region: 59-189
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.49e-33
Family Thioltransferase 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000022695   Gene: ENSMMUG00000017252   Transcript: ENSMMUT00000024251
Sequence length 786
Comment pep:known chromosome:MMUL_1:16:34788372:34797207:1 gene:ENSMMUG00000017252 transcript:ENSMMUT00000024251 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGARAWLGSVLLLPRAGVGLAASRRGSSSRDKDRSATVSSSVPMPAGGKGSHPSSTPQR
VPNRLIHEKSPYLLQHAYNPVDWYPWGQEAFDKARKENKPIFLSVGYSTCHWCHMMEEES
FQNEEIGRLLSEDFVSVKVDREERPDVDKVYMTFVQATSSGGGWPMNVWLTPNLQPFVGG
TYFPPEDGLTRVGFRTVLLRIREQWKQNKNTLLENSQRVTTALLARSEISMGDRQLPPSA
ATMNNRCFQQLDEGYDEEYGGFAEAPKFPTPVILSFLFSYWLSHRLTQDGSRAQQMALHT
LKMMANGGIRDHVGQGFHRYSTDCQWHVPHFEKMLYDQAQLAVAYSQAFQISGDEFYSDV
AKGILQYVARSLSHRSGGFYSAEDADSPPERGMRPKEGAYYVWTVKEVQQLLPEPVLGAT
EPLTSGQLLMKHYGLTEAGNISPSQDPKGELQGQNVLTVRYSLELTAARFGLDVEAVRTL
LNTGLEKLFQARKHRPKPHLDSKMLAAWNGLMVSGYAVTGAVLGQDRLINYATNGAKFLK
RHMFDVASGRLMRTCYTGSGGTVEHSNPPCWGFLEDYAFVVRGLLDLYEASQESAWLEWA
LRLQDTQDRLFWDSQGGGYFCSEAELGAGLPLRLKDDQDGAEPSANSVSAHNLLRLHGFT
GHKDWMDKCVCLLTAFSERMRRVPVALPEMVRALSAQQQTLKQIVICGDRQAKDTKALVQ
CVHSVYIPNKVLILADGDPSSFLSRQLPFLSTLRRLEDQATAYVCENQACSMPITDPCEL
RKLLHP
Download sequence
Identical sequences A0A2K5NTT3 A0A2K5VMU9
ENSMMUP00000022695 XP_001099418.1.72884 XP_005583746.1.63531 XP_011901530.1.92194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]