SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000022719 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000022719
Domain Number 1 Region: 36-129
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.19e-34
Family SCAN domain 0.00000292
Further Details:      
 
Domain Number 2 Region: 634-690
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.35e-24
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 3 Region: 364-421
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.96e-23
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 4 Region: 522-578
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.84e-22
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 5 Region: 577-634
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.02e-22
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 6 Region: 675-727
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.27e-18
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 7 Region: 406-458
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.88e-17
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 8 Region: 484-535
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000474
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000022719   Gene: ENSMMUG00000017267   Transcript: ENSMMUT00000024275
Sequence length 734
Comment pep:known chromosome:MMUL_1:19:64333278:64343854:-1 gene:ENSMMUG00000017267 transcript:ENSMMUT00000024275 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPAVLGSPDRAPPEEEGPVMVKLEDSEEEGEAALWDPGPEAARLRFRCFRYEEATGPQE
ALAQLRELCRQWLRPEVRSKEQMLELLVLEQFLGALPPEIQARMQGQRPGSPEEAAALVD
GLRREPGEPRRWVTVQVQGQEVLSEKMEPSSFQPLPQTEPPTTEPVPKTPPRTMQEAPLG
LQVKEEPEVTEDSDFLESGPLAATQESVPTLLPEAAQGCGTVLDQDFPHSNTGPEGPPWR
EHPRALWHEEAGDIFSPGFALQLNSVSAGPGSVSPHLHVPWDLGMAGLSGQIQSPSREGG
FAHALVLPSDLRSEQDPTEEDPCRGVGPALVTTRWRSPRGRSRGRPSTGGGVVRGGRCDV
CGKVFSQRSNLLRHQKIHTGERPFMCSECGRSFSRSSHLLRHQLTHTEERPFVCGDCGQG
FVRSARLEEHRRVHTGEQPFRCAECGQSFRQRSNLLQHQRIHGDPPGPGATPSAPPGAPE
PPGPFPCSECRESFARRSVLLEHQAVHTGDKSFGCVECGERFGRRSVLLQHRRVHSGERP
FACAECGQSFRQRSNLTQHRRIHTGERPFACAECGKAFRQRPTLTQHLRVHTGEKPFACP
ECGQRFSQRLKLTRHQRTHTGEKPYHCGECGLGFTQVSRLTEHQRIHTGERPFACPECGQ
SFRQHANLTQHRRIHTGERPYACPECGKAFRQRPTLTQHLRTHRREKPFACQDCGRRFHQ
STKLIQHQRIHSAE
Download sequence
Identical sequences A0A2K5VNA6 F7GWV6
XP_001099833.1.72884 XP_005590686.1.63531 ENSMMUP00000022719 9544.ENSMMUP00000022719 ENSMMUP00000022719

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]