SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000022782 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000022782
Domain Number 1 Region: 276-328
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000227
Family Myb/SANT domain 0.00013
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000022782
Domain Number - Region: 377-420
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0143
Family Erythroid transcription factor GATA-1 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000022782   Gene: ENSMMUG00000017313   Transcript: ENSMMUT00000024340
Sequence length 705
Comment pep:known_by_projection chromosome:MMUL_1:7:168798936:168833314:1 gene:ENSMMUG00000017313 transcript:ENSMMUT00000024340 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DYVYFENSSSNPYLIRRIEELNKTANGNVEAKVVCFYRRRDISSTLIALADKHATLSVCY
KAGPGADNGEEGEIEEEMENPEMVDLPEKLKHQLRHRELFLSRQLESLPATHIRGKCSVT
LLNETESLKSYLEREDFLFYSLVYDPQQKTLADKGEIRVGNRYQADITDLLKEGEEDGRD
QSKLETKVWEAHNPLTDKQIDQFLVVARSVGTFARALDCSSSVRQPSLHMSAAAASRDIT
LFHAMDTLHKNIYDISKAISALVPQGGPVLCRDEMEEWSASEANLFEEALEKYGKDFTDI
QQDFLPWKSLTSIIEYYYMWKTTDRYVQQKRLKAAEAESKLKQVYIPNYNKPNPNQISVN
NVKAGVVNGTGAPGQSPGAGRACESCYTTQSYQWYSWGPPNMQCRLCASCWTYWKKYGGL
KMPTRLDGERPGPNRSNMSPHGLPARSSGSPKFAMKTRQAFYLHTTKLTRIARRLCREIL
RPWHAARHPYLPINSAAIKAECTARLPEASQSPLVLKQAVRKPLEAVLRYLETHPRPPKP
DPVKSVSSVLSSLTPAKAAPVINNGSPTILGKRSYEQHNGVDGNMKKRLLMPSRGLANHG
QTRHMGPSRNLLLNGKSYPTKVRLIRGGSLPPVKRRRMNWIDAPDDVFYMATEETRKIRK
LLSSSETKRAARRPYKPIALRQSQALPLRPPPPAPVNDEPIVIED
Download sequence
Identical sequences ENSMMUP00000022782 9544.ENSMMUP00000022782 ENSMMUP00000022782

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]