SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000022931 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000022931
Domain Number 1 Region: 434-668
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.98e-31
Family Voltage-gated potassium channels 0.019
Further Details:      
 
Domain Number 2 Region: 776-931,971-1049
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.02e-29
Family Voltage-gated potassium channels 0.022
Further Details:      
 
Domain Number 3 Region: 26-196,246-274
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.57e-26
Family Voltage-gated potassium channels 0.019
Further Details:      
 
Domain Number 4 Region: 1095-1303,1331-1354
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.32e-25
Family Voltage-gated potassium channels 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000022931   Gene: ENSMMUG00000017414   Transcript: ENSMMUT00000024498
Sequence length 1417
Comment pep:novel chromosome:MMUL_1:1:169379025:169444829:1 gene:ENSMMUG00000017414 transcript:ENSMMUT00000024498 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RPPRALFCLTLENPLRKACISIVEWKPFETIILLTIFANCVALAVYLPMPEDDNNSLNLG
LEKLEYFFLIVFSIEAAMKIIAYGFLFHQDAYLRSGWNVLDFTIVFLGVFTVILEQVNVI
QSNTAPMSSKGAGLDVKALRAFRVLRPLRLVSGVPSLQVVLNSIFKAMLPLFHIALLVLF
MVIIYAIIGLELFKGKMHKTCYFTGTDIVATVENEEPSPCARTGSGRRCTINGSECRGGW
PGPNHGITHFDNFGFSMLTVYQCITMEGWTDVLYWVGLGPGLPEPSPFIHRAVLFETVLL
SSHPSTAEREFTKEREKAKSRGTFQKLREKQQLDEDLRGYMSWITQGEVMDVEDFREGLG
PKAGKVCPAQRGPEGWLTLSLLSPGKLSLDEGGSDTESLYEIAGLNKIIQFIMGRHWRQW
NRIFRWKCHDVVKSKVFYWLVILIVALNTLSIASEHHNQPLWLTRLQDIANRVLLSLFTV
EMLMKMYGLGLRQYFMSIFNRFDCFVVCSGILEILLVESGAMTPLGISVLRCIRLLRIFK
ITKYWTSLSNLVASLLNSIRSIASLLLLLFLFIVIFALLGMQLFGGRYDFEDTEVRRSNF
DNFPQALISVFQVLTGEDWTSMMYNGIMAYGGPSYPGMLVCIYFIILFVCGNYILLNVFL
AIAVDNLAEAESLTSAQKAKAEGKGRGCKEMRKGGVEGVWAGQQEESLTKGTGREPRETP
GDDEEDEPEIPLSPRPRPLAELQLKEKAVPIPEASSFFIFSPTNKIRVLCHRIVNATWFT
NFILLFILLSSAALAAEDPIRADSMRNQILKHFDIGFTSVFTVEIVLKMTTYGAFLHKGS
FCRNYFNMLDLLVVAVSLISMGLESSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCMF
VAISTIGNIVLVTTLLQFMFACIGVQLFKGKFFRCTDLSKMTEEECRGYYYVYKDGDPMQ
IELRHREWVHSDFHFDNVLSAMMSLFTVSTFEGWPQLLYKAIDSNEEDVGPIYNNRVEMA
IFFIIYIILIAFFMMNIFVGFVIVTFQEQGETEYKNCELDKNQRQCVQYALKARPLRCYI
PKNPYQYQVWYVVTSSYFEYLMFALIMLNTICLGMQHRYQALGFVHISDILNVAFTIIFT
LEMILKLMAFKARGYFGDPWNVFDFLIVIGSIIDVILSEIDNILTSGAAAPQDPDESARI
SSAFFRLFRVMRLIKLLSRAEGVRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQMFG
KIALVDGTQINRNNNFQTFPQAVLLLFRHVSPTAPTPTPLTSQPLLCCNLHPPAGPGRSR
LCDPNPGPPAFLCWDSLFLLLQVINLFVAVIMDNFDYLTRDWSILGPHHLDEFKAIWAEY
DPEAKGRIKHLDVVTLLRRIQPPLGFGKFCPHRVACK
Download sequence
Identical sequences ENSMMUP00000022931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]