SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000023183 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000023183
Domain Number 1 Region: 97-216
Classification Level Classification E-value
Superfamily PX domain 7.63e-16
Family PX domain 0.0036
Further Details:      
 
Domain Number 2 Region: 298-352
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000275
Family SAM (sterile alpha motif) domain 0.0059
Further Details:      
 
Domain Number 3 Region: 895-925
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000384
Family Retrovirus zinc finger-like domains 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000023183   Gene: ENSMMUG00000017615   Transcript: ENSMMUT00000024770
Sequence length 949
Comment pep:known chromosome:MMUL_1:20:85529072:85618882:-1 gene:ENSMMUG00000017615 transcript:ENSMMUT00000024770 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASNHPAFSFHQKQVLRQELTQIQSSLNGGGGHGGKGAPGPGGALPTCPACHKITPRTEA
PVSSVSNSLENALHTSAHSTEESLPKRPLGKHSKVSVEKIDLKGLSHTKNDRNVECSFEV
LWSDSSITSVTKSSSEVTEFISKLSQLYPEENLEKLIPCLAGPDAFYVERNHVDLDSGLR
YLASLPSHVLKNDHVRRFLSTSSPPQQLQSPSPGNPSLSKVGTVMGVSGRPVCGVAGIPS
SQSGAQHHGQHPAGSAAPLPHCSHAGSAGSALAYRTQMDTSPAILMPSSLQTPQTQEQNG
ILDWLRKLRLHKYYPVFKQLSMEKFLSLTEEDLNKFESLTMGAKKKLKTQLELEKEKSER
RCLNPSAPSLVTSSGVARVPPTSHIGPVQSGRGSHAAELRVEVEQPHHQLPREGSSSEYS
SSSSSPMGVQAREESSDSAEENDRRVEIHLESSDKEKPVMLLNHFTSSSARPTAQVLPVQ
NEASSNPSGHHPLPPQMLSTASHIAPIRMLNSVHKPERGSADMKLLSSSVHSLLSLEERN
KGSGPRSSMKVDKSFGSAMMDVLPASAPHQPVQVLSGLSESSSMSPTVSFGPRAKVVHAS
TLDRVLKTAQQPALVVETSTAATGTPSTVLHAARPPIKLLLSSSVPADSAISGQTSCPNN
VQISVPPAIINPRTALYTANTKVAFSAMSSMPVGPLQGGFCANSNTASPSSHPSTSFANM
ATLPSCPAPSSSPALSSVPESSFYSNSGGGGSTGNIPASNPNHHHHHHHQQPPAPPQPAP
PPPGCIVCTSCGCSGSCGSSGLTVSYANYFQHPFSGPSVFTFPFLPFSPMCSSGYVSAQQ
YGGGSTFPVVHAPYSSSGTPDPVLSGQSTFAVPPMQNFMAGTAGVYQTQGLVGSSNGSSH
KKSGNLSCYNCGATGHRAQDCKQPSMDFNRPGTFRLKYAPPAESLDSTD
Download sequence
Identical sequences F6WA97
9544.ENSMMUP00000023183 ENSMMUP00000023183 XP_011751557.1.29376 ENSMMUP00000023183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]