SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000023399 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000023399
Domain Number 1 Region: 254-334
Classification Level Classification E-value
Superfamily Small-conductance potassium channel 2.88e-35
Family Small-conductance potassium channel 0.0000216
Further Details:      
 
Domain Number 2 Region: 104-276
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.53e-18
Family Voltage-gated potassium channels 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000023399   Gene: ENSMMUG00000017793   Transcript: ENSMMUT00000025008
Sequence length 424
Comment pep:known_by_projection chromosome:MMUL_1:1:133247009:133360460:-1 gene:ENSMMUG00000017793 transcript:ENSMMUT00000025008 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQDSMFSLALKCLISLSTIILLGLIIAYHTREVQLFVIDNGADDWRIAMTYERILYISLE
MLVCAIHPIPGEYKFFWTARLAFSYTPSRAEADVDIILSIPMFLRLYLIARVMLLHSKLF
TDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRVCERYHDQQD
VTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMAGGKSAMVSHFSVDFSKLE
LTEAGTGERALTNDKKLSAGIKNAAANVLRETWLIYKHTKLLKKIDHAKVRKHQRKFLQA
IHQLRSVKMEQRKLSDQANTLVDLSKMQNVMYDLITELNDRSEDLEKQIGSLESKLEHLT
ASFNSLPLLIADTLRQQQQQLLSAIIEARGVSVAVGTTHTPISDSPIGVSSTSFPTPYTS
SSSC
Download sequence
Identical sequences ENSMMUP00000023399

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]