SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000023413 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000023413
Domain Number 1 Region: 905-1196
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 2.62e-86
Family Complement components 0.0000126
Further Details:      
 
Domain Number 2 Region: 1278-1406
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 2.62e-31
Family Alpha-macroglobulin receptor domain 0.0015
Further Details:      
 
Domain Number 3 Region: 741-794
Classification Level Classification E-value
Superfamily E set domains 0.0000000028
Family SVA-like 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000023413   Gene: ENSMMUG00000017806   Transcript: ENSMMUT00000025025
Sequence length 1444
Comment pep:known chromosome:MMUL_1:4:69935969:70072781:1 gene:ENSMMUG00000017806 transcript:ENSMMUT00000025025 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQGPPLLTAAHLLCVCTAALAAARGPRFLVTTPGIIRPGGNVTIGVELLEHCPSQVTVKA
ELLKTASNLTVSVLEAEGVFEKGSFKTLTLPSLPLNSADEIYELRVTGRTQDEILFSNST
RLSFETKRISVFIQTDKALYKPKQEVKFRIVTLFSDFKPYKTSLNILIKDPKSNLIQQWL
SQQSDLGVISKTFQLSSHPILGDWSIQVQVNDQTYYQSFQVSEYVLPKFEVTLQTPLYCS
MNSKHLNGTIVAKYTYGKPVKGDVTLTFLPLSFWGKKKNITKTFKINGSVNFSFNDEEMK
NIMDSSNGLSEHLDLAAPGPVEILATVTESLTGIARNASTNVFFKQHDYIIEFFDYTTVL
KPSLNFTATVKVTRADGNQLTLEERRNDVVIAVTQGNYTEYWSGSNSGNQKMETVQKINY
TVPQNGTFKIEFPILEDSSELQLKAYFLGSKSSIAVHSMFKSPSKTYIQLKTRDENIKVM
LTTHLIIRGFPAFKKTLKLVVSRGQLVAVGKQNSTIFSLTPENSWTPKACVIVYYIEDDG
EIINDVLKIPVQLVFKNKIKLYWSKVKAEPSEKVSLRMSVTQPDSIVGIVAVDKSVNLMY
ASNDITMENVVHELELYNTGYYLGMFMNSFAVFQECGLWVLTDANLTKDYIDGVYDNAEY
AERFMEENEGHVDIQDFSLGSSPHVRKHFPETWIWLDTNMGSRIYQEFEVTVPDSITSWV
ATGFVISEDLGLGLTKTPVELQAFQPFFIFLNLPYSVIRGEEFALEITIFNYLKDATEVK
VIIEKSDKFDILMTSSEINATGHQQTILVPSEDGATVLFPIRPTHLGEIPITVTALSPTA
SDAITQMILVKAEGIEKSYSQSILLDLTDNRLQSTLKTLSFSFPPNTVTGSERVQITAIG
DVLGPSINGLASLIRMPYGCGEQNMIHFAPNIYILDYLTKKKQLTDNLKEKALSFMRQGY
QRELLYQREDGSFSAFGNYDASGSTWLSAFVLRCFLEADPYIDIDQNVLHRTYTWLKERQ
KSNGEFWEPGRVIHSELQGGNKSPVTLTAYIVTSLLGYRKYQPNIDVQESIHFLESEFSR
GISDNYTLALIAYALSSVGSPKAKEALNMLTSRAEQEGGMQFWVSSESKLSDSWQPRSLD
IEVAAYALLSHFLQFQASEGIPIMRWLSRQRNSLGGFASTQDTIVALKALSEFAALMITE
RTNIQVTVTGPSAPSPIKFLIDTHNRLLLQTAELAVVQPTAVNISATGFGFAICQLNVVY
NVKDSGSSRRRRSIQNQEAFDLDVAVKENKDDLNHVDLNVCTRFLGPARSGMALMEVNLL
SGFMVPSDTIPLSETVKKVEYDHGKLNLYLDSVNETQFCVDIPAVRNFKVSNTQDASVSI
VDYYEPRRQAVRSYNSEAKLSSCDLCSDVQGCHPCEDGAVGSHHHPSVIFIFCFTLLYFL
ELWL
Download sequence
Identical sequences ENSMMUP00000023413 ENSMMUP00000023413 9544.ENSMMUP00000023413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]