SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000023454 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000023454
Domain Number 1 Region: 111-229
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.97e-57
Family Calsequestrin 0.000000551
Further Details:      
 
Domain Number 2 Region: 9-108
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.47e-27
Family Calsequestrin 0.00000602
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000023454   Gene: ENSMMUG00000017837   Transcript: ENSMMUT00000025069
Sequence length 244
Comment pep:known_by_projection chromosome:MMUL_1:1:138817256:138823199:1 gene:ENSMMUG00000017837 transcript:ENSMMUT00000025069 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFQVLEDPVELIEGERELQAFENIEDEIKLIGYFKSKDSEHYKAFEDAAEEFHPYIPFFA
TFDSKVAKKLTLKLNEIDFYEAFMEEPVTIPDKPNSEEEIVNFVEEHRRSTLRKLKPESM
YETWEDDMDGIHIVAFAEEADPDGFEFLETLKAVAQDNTDNPDLSIIWIDPDDFPLLVPY
WEKTFDIDLSAPQIGVVNVTDADSVWMEMDDEEDLPSAEELEDWLEDVLEGEINTEDDDD
DDDD
Download sequence
Identical sequences 9544.ENSMMUP00000023454 ENSMMUP00000023454 ENSMMUP00000023454

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]