SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000023632 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000023632
Domain Number 1 Region: 254-456
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.45e-47
Family Reprolysin-like 0.0019
Further Details:      
 
Domain Number 2 Region: 548-603
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000484
Family TSP-1 type 1 repeat 0.00039
Further Details:      
 
Domain Number 3 Region: 967-1013
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000144
Family TSP-1 type 1 repeat 0.0017
Further Details:      
 
Domain Number 4 Region: 906-964
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000183
Family TSP-1 type 1 repeat 0.0034
Further Details:      
 
Domain Number 5 Region: 844-902
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000693
Family TSP-1 type 1 repeat 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000023632   Gene: ENSMMUG00000017977   Transcript: ENSMMUT00000025259
Sequence length 1203
Comment pep:known chromosome:MMUL_1:5:57089180:57376976:1 gene:ENSMMUG00000017977 transcript:ENSMMUT00000025259 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLLSLWLIAAALVEVRTSADGQAGNEEMVQIDLPIKRYREYELVTPVSTNLEGHYLSHT
LSASHKKRSARDVSSNPEQLFFNITAFGKDFHLRLKPNTQLVAPGAVVEWRETSLVPGNI
TDPINNHQPGSSSFRRSEITPLHSSLGDRVRLYGVTLTKNQCQGLSAGMIKSDNEEYFIE
PLERGKQMEEEKGRIHVVYKRSAVEQAPIDMSKDFHYRESDLEGLDDLGTVYGNIHQQLN
ETMRRRRHAGENDYNIEVLLGVDDSVVRFHGKEHVQNYLLTLMNIVNEIYHDESLGVHIN
VVLVRMIMLGYAKSISLIERGNPSRSLENVCRWASQQQRSDLNHSEHHDHAIFLTRQDFG
PAGMQGYAPVTGMCHPVRSCTLNHEDGFSSAFVVAHETGHVLGMEHDGQGNRCGDETAMG
SVMAPLVQAAFHRYHWSRCSGQELKRYIHSYDCLLDDPFDHDWPKLPELPGINYSMDEQC
RFDFGVGYKMCTAFRTFDPCKQLWCSHPDNPYFCKTKKGPPLDGTECAAGKWCYKGHCMW
KNANQQKQDGNWGSWTKFGSCSRTCGTGVRFRTRQCNNPMPINGGQDCPGVNFEYQLCNT
EECQKHFEDFRAQQCQQRNSHFEYQNTKHHWLPYEHPDPKKRCHLYCQSKETGDVAYMKQ
LVHDGTRCSYKDPYSICVRGECVKVGCDKEIGSNKVEDKCGVCGGDNSHCRTVKGTFTRT
PRKLGYLKMFDIPPGARHVLIQEDEASPHILAIKNQATGHYILNGKGEEAKSRTFIDLGV
EWDYNIEDDVESLHTDGPLHDPVIVLIIPQENDTRSSLTYKYIIHEDSVPMINSNNVIQE
EFDTFEWALKSWSQCSKPCGGGFQYTKYGCRRKSDNKMVHRSFCEANKKPKPIRRMCNIQ
ECTHPLWVAEEWEHCTKTCGSSGYQLRTVRCLQPLHDGTNRSVHSKYCMGDRPESRRPCN
RVPCPAQWKTGPWSECSVTCGEGTEVRQVLCRAGDHCDGEKPESVRACQLPPCNDEPCLG
DKSIFCQMEVLARYCSIPGYNKLCCESCSKRSSTLPPPYLLEAAETHDDVVSNPSDLPRS
LVMPTSLVPYHSETPAKKTSLSSISSVGGPNAYAAFRSNSKPDGANLPQRSAQQAGSKTV
RLVATPSSPPTKRGHLSSASQMAAASFFAASDSIGASSQARTSQKDGKIIDNRRPTRSST
LER
Download sequence
Identical sequences ENSMMUP00000023632 9544.ENSMMUP00000023632 ENSMMUP00000023632

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]