SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000023677 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000023677
Domain Number 1 Region: 514-657
Classification Level Classification E-value
Superfamily Clathrin adaptor appendage domain 2.48e-53
Family gamma-adaptin C-terminal appendage domain-like 0.000000117
Further Details:      
 
Domain Number 2 Region: 107-235
Classification Level Classification E-value
Superfamily GAT-like domain 1.79e-36
Family GAT domain 0.00000498
Further Details:      
 
Domain Number 3 Region: 1-90
Classification Level Classification E-value
Superfamily ENTH/VHS domain 1.48e-24
Family VHS domain 0.00000518
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000023677   Gene: ENSMMUG00000018021   Transcript: ENSMMUT00000025311
Sequence length 657
Comment pep:known_by_projection chromosome:MMUL_1:16:70531971:70539779:-1 gene:ENSMMUG00000018021 transcript:ENSMMUT00000025311 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQVLEACMKNCGRRFHNEVGKFRFLNELIKVVSPKYLGDRVSEKVKTKVIELLYSWTMAL
PEEAKIKDAYHMLKRQGIVQSDPPIPVDRTLIPSPPPRPKNPVFDDEEKSKLLAKLLKSK
NPDDLQEANKLIKSMVKEDEARIQKVTKRLHTLEEVNNNVRLLNEMLLHYSQEDSSDGDR
ELMKELFDRCENKRRTLFKLASETEDNDNSLGDILQASDNLSRVINSYKTIIEGQVINGE
VATLTLPDSEGNSQCSNQGTLIDLAELDTTNSLSSVLAPAPTPPSSDIPILPPPPQASGP
PRSRSSSQAEATPGPNSTSNALSLLDEELLCLGLADPAPNVPPKESAGNSQWHLLQREQS
DLDFFSPRPGTTACGASDAPLLQPSAPSSSSQAPLPSPFPAPVVPASVPAPSAGSFLFST
GVAPALAPKVEPAVPGHHGLALGDSVLHHLDALDQLLEEAKVTSGLVKPATSPLISTTTP
ARPLLPFSTAPGSPLFQPLSFQSQGSPLKGPELSLASIHVPLESIKPSSALPITAYDKNG
FRILFHFAKECPPGRPDVLVVVVSMLNTAPLPVKSIVLQAAVPKSMKVKLQPPSGTELSP
FSPIQPPAAITQVMLLANPLKEKVRLRYKLTFALGEQLSTEVGEVDQFPPVEQWGNL
Download sequence
Identical sequences ENSMMUP00000023677 9544.ENSMMUP00000023677 ENSMMUP00000023677

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]