SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000023838 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000023838
Domain Number 1 Region: 291-348
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.47e-26
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 2 Region: 599-656
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.28e-25
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 3 Region: 543-600
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.27e-25
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 4 Region: 655-712
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.28e-25
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 5 Region: 431-488
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.82e-25
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 6 Region: 711-768
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.93e-24
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 7 Region: 3-63
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.31e-23
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 8 Region: 487-544
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.02e-22
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 9 Region: 375-432
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.02e-21
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 10 Region: 757-809
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.59e-20
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 11 Region: 179-236
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.61e-20
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 12 Region: 235-292
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.89e-18
Family Classic zinc finger, C2H2 0.009
Further Details:      
 
Domain Number 13 Region: 141-191
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.1e-16
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 14 Region: 338-370
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000271
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000023838   Gene: ENSMMUG00000003688   Transcript: ENSMMUT00000025480
Sequence length 816
Comment pep:known_by_projection chromosome:MMUL_1:19:22395095:22408754:-1 gene:ENSMMUG00000003688 transcript:ENSMMUT00000025480 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VCVFQGLLTFRDVAIEFSLEEWQRLDAAQQNLYRNVMLENYRNLAFLGNFSFQPDLITCL
EQGKEPWNMKRHEMVDKAPVCLKCVRVVGVSCFPPTINIKNLCPVSEQGMEDSFQKVLLR
KYEKCGHENLQLRKSCKSVEKSYKCKECEKIFHWSSTLTNHKKIHTEDKPYKCEECGKAF
KQLSTLITHKITCAEEKIYKCEECGKTFNQSSNLTTHKIIHSGQKPYKCEQCGKAFIWLS
TLTGHKKIHTRGKPCKYEECGKAFICSPTLTRRKRIHTEEKLYKCEECGKAFLWSSTLTR
HKRIHTGEKPYKCEECGKAFRQSSTLTKHKRIHTGEKPYKCEECGKAFRQSLTLTKHKII
HSGEKHYKCKECGKTFKQFSTLTTHKIIHAGKKCYKCEECGKAFNQSSSLSTHKIIHTGE
KSYKCEECGKAFIWSSTLTRHKRIHTGEKPCKCEECGKAFSHSSTLAKHKRIHTGEKPYK
CKECGKAFSNSSTLTNHKITHTEEKPYKCKECGKAFKRLSTLTKHKIIHAGEKLYKCEEC
GKAFNRSSNLTAHKIIHTGEKPYKCEECGKAFIWSSSLTKHKRIHTREKPYKCEECGKAF
SQPSHLTTHKRMHTGEKPYKCEECGKAFSQSSTLTTHKIIHTGEKPYKCEECGKAFRKSS
TLTEHKIIHTGEKPYKCEECGKAFSQSSTLTRHKRMHTGEKPYKCEECGKAFNRSSKLTT
HKIIHTGEKPYKCEECGKAFISSSTLTGHKRIHTREKPYKCEECGKAFSQSSTLTRHKRM
HTGEKPYKCEECGKAFKESSALTKHKIIHTGEKPYK
Download sequence
Identical sequences ENSMMUP00000023838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]