SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000023845 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000023845
Domain Number 1 Region: 377-434
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.46e-24
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 2 Region: 265-322
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.23e-24
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 3 Region: 209-266
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.59e-24
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 4 Region: 1-59
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.44e-23
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 
Domain Number 5 Region: 321-378
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.59e-23
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 6 Region: 546-602
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.66e-23
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 7 Region: 433-488
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.54e-23
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 8 Region: 493-546
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.12e-22
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 9 Region: 591-643
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.77e-19
Family Classic zinc finger, C2H2 0.0089
Further Details:      
 
Domain Number 10 Region: 171-223
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.6e-17
Family Classic zinc finger, C2H2 0.0089
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000023845
Domain Number - Region: 140-183
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0101
Family Classic zinc finger, C2H2 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000023845   Gene: ENSMMUG00000018134   Transcript: ENSMMUT00000025487
Sequence length 649
Comment pep:novel chromosome:MMUL_1:20:30259360:30279091:1 gene:ENSMMUG00000018134 transcript:ENSMMUT00000025487 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QGPLTFMDVAIEFSLKEWQCLDTAQQNLYRDVMLENYRNLVFLGIAFSKPDLITYLEQGK
EPWNMKRHETVAKPLVVCSYFAQDLWPEQNVKNSFQKVILRRYGKCGDENLPLRKDCKSM
DDCKMHERVYEKLNKCLTATQSKTFLCYKSLKVVYKFSNSNRCKTIHPKKKPFKCSKCDK
SFCMLLHLIQHKIIHTGEKPYKCEECGKAFNHPSTFSKHKRIHSGDKPYQCEECGKAFKQ
LSNLNNHKRIHTGEKPYKCEECGKAFNHSSTLRKHKRIHTGEKPYKCEECGKAFNHSSIL
GKHKIIHSGEKPYKCEECGKAFNRSSILRKHKVIHSGEKPYKCEECGKAFNHPSTLSKHK
RIHSGDKPYKCEECGKAFKQLSNLNSHKRIHTGEKPFKCETCGKAFTQLSTLRKHKIIHS
GEKPYKCEECGKAFKQSSTLIKHKRIHSGEKPFKCEECGKGFCDSSSLMTHKRIHSGEKP
FKCEECGKGLCDSSSLATHKRIHSGEKPFKCEECGKGFCDSSSLTTHKRVHSGEKPYKCE
ECGKGFCKSSSLTTHKGIHSGEKPYKCEECGKAFNHLSTLTRHKRIHTGEKPFKCEECGK
AFNQLATLTKHKRIHTEEKPYKCEECGNAFKQSSTLTKHKRIHSGEKPF
Download sequence
Identical sequences ENSMMUP00000023845

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]