SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000023847 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000023847
Domain Number 1 Region: 620-677
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.39e-25
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 2 Region: 676-733
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.76e-25
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 3 Region: 788-845
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.94e-24
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 4 Region: 396-453
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.2e-24
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 5 Region: 508-565
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.31e-24
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 6 Region: 732-789
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.21e-24
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 7 Region: 452-509
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.25e-23
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 8 Region: 340-397
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.17e-23
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 9 Region: 284-341
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.94e-23
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 10 Region: 564-621
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.52e-23
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 11 Region: 228-285
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.47e-22
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 12 Region: 172-229
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.52e-20
Family Classic zinc finger, C2H2 0.0089
Further Details:      
 
Domain Number 13 Region: 3-51
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 7.98e-20
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 14 Region: 834-886
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.26e-18
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 15 Region: 134-186
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.8e-17
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000023847   Gene: ENSMMUG00000003688   Transcript: ENSMMUT00000025489
Sequence length 893
Comment pep:known_by_projection chromosome:MMUL_1:19:22394927:22408754:-1 gene:ENSMMUG00000003688 transcript:ENSMMUT00000025489 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VCVFQGLLTFRDVAIEFSLEEWQRLDAAQQNLYRNVMLENYRNLAFLGKVIFLCLIKHLT
PVSEQGMEDSFQKVLLRKYEKCGHENLQLRKSCKSVDECKVHREGYSKLNQCFTTTRSKK
FLNSNRHMISITEKSYKCKECEKIFHWSSTLTNHKKIHTEEKIYKCEECGKTFNQSSNLT
THKIIHSGQKPYKCEQCGKAFIWLSTLTGHKKIHTRGKPCKYEECGKAFICSPTLTRRKR
IHTEEKLYKCEECGKAFLWSSTLTRHKRIHTGEKPYKCEECGKAFRQSSTLTKHKRIHTG
EKPYKCEECGKAFRQSLTLTKHKIIHSGEKHYKCKECGKTFKQFSTLTTHKIIHTGEKSY
KCEECGKAFIWSSTLTRHKRIHTGEKPCKCEECGKAFSHSSTLAKHKRIHTGEKPYKCKE
CGKAFSNSSTLTNHKITHTEEKPYKCKECGKAFKRLSTLTKHKIIHAGEKLYKCEECGKA
FNRSSNLTAHKIIHTGEKPYKCEECGKAFIWSSSLTKHKRIHTREKLFKCKECDKAFIWS
STLTRHKRIHTGEKPYKCEECGKAFNHSSTLTKHKTIHTGEKPYKCKECGKPFKIPSTLA
KHKRIHTREKPYKCEECGKAFSQPSHLTTHKRMHTGEKPYKCEECGKAFSQSSTLTTHKI
IHTGEKPYKCEECGKAFRKSSTLTEHKIIHTGEKPYKCEECGKAFSQSSTLTRHKRMHTG
EKPYKCEECGKAFNRSSKLTTHKIIHTGEKPYKCEECGKAFISSSTLTGHKRIHTREKPY
KCEECGKAFSQSSTLTRHKRMHTGEKPYKCEECGKAFKESSALTKHKIIHTGEKPYKCEK
CGKAFNQSSILTNHKKIHTREKPYTCKECGKSFNRSSTFTKHKVIHTGVKLYK
Download sequence
Identical sequences ENSMMUP00000023847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]