SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000023848 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000023848
Domain Number 1 Region: 4-64
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.7e-24
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 
Domain Number 2 Region: 366-423
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.89e-24
Family Classic zinc finger, C2H2 0.003
Further Details:      
 
Domain Number 3 Region: 310-367
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.92e-24
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 4 Region: 254-311
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.62e-23
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 5 Region: 534-591
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.05e-22
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 6 Region: 479-535
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.81e-22
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 7 Region: 423-479
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.3e-22
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 8 Region: 580-632
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.59e-20
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 
Domain Number 9 Region: 202-255
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.04e-19
Family Classic zinc finger, C2H2 0.0092
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000023848
Domain Number - Region: 140-159
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00436
Family Classic zinc finger, C2H2 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000023848   Gene: ENSMMUG00000018134   Transcript: ENSMMUT00000025490
Sequence length 635
Comment pep:novel chromosome:MMUL_1:20:30259345:30278998:1 gene:ENSMMUG00000018134 transcript:ENSMMUT00000025490 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VCVCFQGPLTFMDVAIEFSLKEWQCLDTAQQNLYRDVMLENYRNLVFLGIAFSKPDLITY
LEQGKEPWNMKRHETVAKPLVLDFFWTIXKKLGVRKDNFEEGIIALILSKYLILYNLKSF
MHHHYDKNVLFQTQTVILKNTLSNLNNHKRIHTGEKPFKEFIVQENPTNVKNVAKAFATP
HPLLHMREFIVGKNPTNVKNVFSNLTTHKRIHNGAKSFKCEECCKAFNQFYKLTVHKRIH
TGEKPYKCEECGKAFNHSSILGKHKIIHSGEKPYKCEECGKAFNRSSILRKHKVIHSGEK
PYKCEECGKAFNHPSTLSKHKRIHSGDKPYKCEECGKAFKQLSNLNSHKRIHTGEKPFKC
ETCGKAFTQLSTLRKHKIIHSGEKPYKCEECGKAFKQSSTLIKHKRIHSGEKPFKCEECG
KGFCDSSSLMTHKRIHSGEKPFKCEECGKGLCDSSSLATHKRIHSGEKPFKCEECGKGFC
DSSSLTTHKRVHSGEKPYKCEECGKGFCKSSSLTTHKGIHSGEKPYKCEECGKAFNHLST
LTRHKIIHSGEKPYKCGECEKAFNHPSTLSKHKRIHSGDKPYKCEECGKGFKQLSNLSNH
KRIHTGEKPFKCEECGKAFNQLATLTKHKRIHTEE
Download sequence
Identical sequences ENSMMUP00000023848

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]