SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000023850 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000023850
Domain Number 1 Region: 321-378
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.5e-25
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 2 Region: 181-238
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.23e-25
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 3 Region: 1-59
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.11e-23
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 
Domain Number 4 Region: 405-462
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.3e-23
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 5 Region: 265-322
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.09e-22
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 6 Region: 447-499
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.87e-21
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 7 Region: 143-195
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000429
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 8 Region: 228-260
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000155
Family Classic zinc finger, C2H2 0.0067
Further Details:      
 
Domain Number 9 Region: 368-400
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000268
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000023850   Gene: ENSMMUG00000018134   Transcript: ENSMMUT00000025492
Sequence length 530
Comment pep:novel chromosome:MMUL_1:20:30259360:30278645:1 gene:ENSMMUG00000018134 transcript:ENSMMUT00000025492 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QGPLTFMDVAIEFSLKEWQCLDTAQQNLYRDVMLENYRNLVFLGIAFSKPDLITYLEQGK
EPWNMKRHETVAKPLVVCSYFAQDLWPEQNVKNSFQKVILRRYGKCGDENLPLRKDCKSM
DDCKMHERVYEKLNKCLTATQSKTFLCYKSLKVVYKFSNSNRYKRIHSGDKPYQCEECGK
AFKQLSNLNNHKRIHTGEKPYKCEECGKAFNHSSTLRKHKIIHSGEKPYKCEECGKAFNR
FSILRKHKIIHSGEKPYKCEECGKAFNHPSTCHKHKIIHSEDKPYKCEECGKAFKQLSNL
NNHKRIHTGEKPFKCEECGKAFNQLSTLTNHKRIHTEEKPYKCEECGKAFKQSSTLTKHK
RIHTGEKPYKCEECGKAFNHSSILGKHKIIHSGEKPYKCEECGKAFNRSSILRKHKVIHS
GEKPYKCEECGKAFNHPSTLSKHKRIHSGDKPYKCEECGKAFKQLSNLNSHKRIHTGEKP
FKCETCGKAFTQLSTLRKHKIREFIVEKNPTNVKNVAKVFASPHPLLHIR
Download sequence
Identical sequences ENSMMUP00000023850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]