SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000023851 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000023851
Domain Number 1 Region: 378-435
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.63e-25
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 2 Region: 266-323
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.25e-25
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 3 Region: 434-491
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.01e-24
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 4 Region: 210-267
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.1e-23
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 5 Region: 1-60
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.62e-21
Family KRAB domain (Kruppel-associated box) 0.0016
Further Details:      
 
Domain Number 6 Region: 322-379
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.96e-20
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 7 Region: 168-220
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000936
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000023851   Gene: ENSMMUG00000018134   Transcript: ENSMMUT00000025493
Sequence length 510
Comment pep:novel chromosome:MMUL_1:20:30259360:30278175:1 gene:ENSMMUG00000018134 transcript:ENSMMUT00000025493 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QGPLTFMDVAIEFSLKEWQCLDTAQQNLYRDVMLENYRNLVFLAGIAFSKPDLITYLEQG
KEPWNMKRHETVAKPLVVCSYFAQDLWPEQNVKNSFQKVILRRYGKCGDENLPLRKDCKS
MDDCKMHERVYEKLNKCLTATQSKTFLCYKSLKVVYKFSNSNRCKTIHPKKKPFKCSKCD
KSFCMLLHLIQHKIIHTRVSSYKCEECGKVFNRSSYLTTHKIIHTGEKPYKCEECGKAFN
HPSTFSKHKRIHSGDKPYQCEECGKAFKQLSNLNNHKRIHTGEKPYKCEECGKAFNHSST
LRKHKIIHSGEKPYKCEECGKAFNRFSILRKHKIIHSGEKPYKCEECGKAFNHPSTCHKH
KIIHSEDKPYKCEECGKAFKQLSNLNNHKRIHTGEKPFKCEECGKAFNQLSTLTNHKRIH
TEEKPYKCEECGKAFKQSSTLTKHKRIHTGEKPYKCEECGKAFNHSSILGKHKIIHSGEK
PYKCEECGKAFNRSSILRKQNSYWREALQM
Download sequence
Identical sequences ENSMMUP00000023851

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]