SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000023987 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000023987
Domain Number 1 Region: 33-94
Classification Level Classification E-value
Superfamily BPTI-like 8.8e-18
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000023987   Gene: ENSMMUG00000018248   Transcript: ENSMMUT00000025640
Sequence length 99
Comment pep:novel chromosome:MMUL_1:10:18755685:18757437:-1 gene:ENSMMUG00000018248 transcript:ENSMMUT00000025640 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSAKLGFLLRFFIFCSLNTLLLGGVNKIAEKICGDLKDPCKLDMNVGSCYEVHFRYFYN
RTSKRCESFVFSGCDGNLNNFKLKLECDVTCVTKYKPPE
Download sequence
Identical sequences G7N4P5
ENSMMUP00000023987 ENSMMUP00000023987 9544.ENSMMUP00000023987

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]