SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000024352 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000024352
Domain Number 1 Region: 1193-1348,1390-1466
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.04e-38
Family Voltage-gated potassium channels 0.022
Further Details:      
 
Domain Number 2 Region: 1516-1712,1740-1765
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 6.91e-38
Family Voltage-gated potassium channels 0.022
Further Details:      
 
Domain Number 3 Region: 127-272,342-411
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.41e-32
Family Voltage-gated potassium channels 0.015
Further Details:      
 
Domain Number 4 Region: 746-893,927-974
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.35e-30
Family Voltage-gated potassium channels 0.017
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000024352
Domain Number - Region: 1773-1819
Classification Level Classification E-value
Superfamily EF-hand 0.00254
Family Calmodulin-like 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000024352   Gene: ENSMMUG00000018510   Transcript: ENSMMUT00000026025
Sequence length 1989
Comment pep:known_by_projection chromosome:MMUL_1:12:29855911:29965744:-1 gene:ENSMMUG00000018510 transcript:ENSMMUT00000026025 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMLPPPGPQSFVHFTKQSLALIEQRIAERKSKEPKEEKKDDDEEAPKPSSDLEAGKQLP
FIYGDIPPGMVSEPLEDLDPYYADKKTFIVLNKGKTIFRFNATPALYMLSPFSPLRRISI
KILRQNTTLFSMLIMCTILTNCIFMTMSNPPDWTKNVEYTFTGIYTFESLVKILARGFCV
GEFTFLRDPWNWLDFIVIVFAYLTEFVNLGNVSALRTFRVLRALKTISVIPGLKTIVGAL
IQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLKHKCVQNSLVNNETLESIMNTLESEED
FRKYFYYLEGSKDALLCGFSTDSGQCPEGYTCMKIGRNPDYGYTSFDTFSWAFLALFRLM
TQDYWENLYQQTLRAAGKTYMIFFVVVIFLGSFYLINLILAVVAMAYEEQNQANIEEAKQ
KELEFQQMLDRLKKEQEEAEAIAAAAAEYTSIRRSRIMGLSESSSETSKLSSKSAKERRN
RRKKKNQKKLSSGEEKGDAEKLSKSDSEENIRRKSFHLGVEGHRRAHEKRLSTPSQSPLS
IRGSLFSARRSSRTSLFSFKGRGRDIGSETEFADDEHSIFGDNESRRGSLFVPHRPQERR
SSNISQASRSPPILPVNGKMHSAVDCNGVVSLVDGRSALMLPNGQLLPEVIIDKATSDDS
GTTNQIHKKRRCSSYLLSEDMLNDPNLRQRAMSRASILTNTVEELEESRQKCPPWWYRFA
HKFLIWNCSPYWIKFKKCIYFIVMDPFVDLAITICIVLNTLFMAMEHHPMTEEFKNVLAI
GNLVFTGIFAAEMVLKLIAMDPYEYFQVGWNIFDSLIVTLSLVELFLADVEGLSVLRSFR
LLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSYKECVCK
INDDCTLPRWHMNDFFHSFLIVFRVLCGEWIETMWDCMEVAGQAMCLIVYMMVMVIGNLV
VLNLFLALLLSSFSSDNLTAIEEDPDANNLQIAVTRIKKGINYVKQTLREFILKTFSKKP
KISREIRQTEDLNTKKENYISNYTLAEMSKGHNFLKEKDKISGFGSCVDKYLMEDSDGQS
FIHNPSLTVTVPIAPGESDLENMNTEELSSDSDSEYSKVRLNQSSSSECSTVDNPLPGEG
EEAEAEPMNSDEPEACFTDGCVRRFSCCQVNIESGKGKIWWNIRKTCYKIVEHSWFESFI
VLMILLSSGALAFEDIYIERKKTIKIILEYADKIFTYIFILEMLLKWIAYGYKTYFTNAW
CWLDFLIVDVSLVTLVANTLGYSDLGPIKSLRTLRALRPLRALSRFEGMRVVVNALIGAI
PSIMNVLLVCLIFWLIFSIMGVNLFAGKFYECINTTDGSRFPASQVPNRSECFALMNVSQ
NVRWKNLKVNFDNVGLGYLSLLQVATFKGWTIIMYAAVDSVNVDKQPKYEYSLYMYIYFV
IFIIFGSFFTLNLFIGVIIDNFNQQKKKISQDIFMTEEQKKYYNAMKKLGSKKPQKPIPR
PGNKIQGCIFDLVTNQAFDISIMVLICLNMVTMMVEKEGQSPYMTDVLYWINVVFIILFT
GECVLKLISLRYYYFTIGWNIFDFVVVIISIVGMFLADLIETYFVSPTLFRVIRLARIGR
ILRLVKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMSNFAYVKKEDGINDMF
NFETFGNSMICLFQITTSAGWDGLLAPILNSKPPDCDPKKVHPGSSVEGDCGNPSVGIFY
FVSYIIISFLVVVNMYIAVILENFSVATEESTEPLSEDDFEMFYEVWEKFDPDATQFIEY
NKLSDFAAALDPPLLIAKPNKVQLIAMDLPMVSGDRIHCLDILFAFTKRVLGESGEMDSL
RSQMEERFMSANPSKVSYEPITTTLKRKQEDVSATVIQRAYRRYRLRQNVKNISSIYIKD
GDRDDDLLNKKDMAFDNVNENSSPEKTDATSSTTSPPSYDSVTKPDKEKYEQDRTEKEDK
GKDSKESKK
Download sequence
Identical sequences ENSMMUP00000024352 ENSMMUP00000024352

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]