SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000024397 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000024397
Domain Number 1 Region: 36-123
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 3.71e-36
Family SCAN domain 0.0000526
Further Details:      
 
Domain Number 2 Region: 444-498
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.45e-20
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 3 Region: 408-458
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000359
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 4 Region: 222-267
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000000562
Family KRAB domain (Kruppel-associated box) 0.0038
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000024397
Domain Number - Region: 331-352
Classification Level Classification E-value
Superfamily TTHA1013/TTHA0281-like 0.0144
Family TTHA0281-like 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000024397   Gene: ENSMMUG00000018541   Transcript: ENSMMUT00000026070
Sequence length 498
Comment pep:known chromosome:MMUL_1:16:11720123:11735003:-1 gene:ENSMMUG00000018541 transcript:ENSMMUT00000026070 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVDLGQALGLLPSLAKAEGSQFSESDAALQEELSSPETARQLFRQFRYQVMSGPHETLK
QLRKLCFQWLQPEVHTKEQILEILMLEQFLTILPGEIQMWVRKQCPGSGEEAVTLVESLK
GDPQRLWQWISIQVLGQDILSEKMESPSCQVGEVEPHLEVVPQELGLENSSVGPGELLSH
IVKEESDTEAELALAASQPARPEERLIRDQDLGASLLPAAPQEQWRHLDSTQKEQYWDLM
LETYGKMVSGAGISHSKPDLTNSIEYGEELAGLYLHVNEKVPRPTCIGDRQENDKENLNL
ENHRDQELLHASCQASGEVPSQASLRGFFSEDEPGCFGEGENLPEALQNIQDEGTGEQLS
PPERISEKQLGQHLPNPHSGEMSTMWLEEKRETSQKGQPRAPMAQKLPTCRECGKTFYRN
SQLVFHQRTHNGETYFQCTICKKAFLRSSDFVKHQRTHTGEKPCKCDYCGKGFSDFSGLR
HHEKIHTGEKPYKCPICE
Download sequence
Identical sequences ENSMMUP00000024397 ENSMMUP00000024397 9544.ENSMMUP00000024397

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]