SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000024450 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000024450
Domain Number 1 Region: 170-413
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.77e-48
Family Voltage-gated potassium channels 0.00089
Further Details:      
 
Domain Number 2 Region: 11-121
Classification Level Classification E-value
Superfamily POZ domain 2.09e-24
Family Tetramerization domain of potassium channels 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000024450   Gene: ENSMMUG00000018583   Transcript: ENSMMUT00000026127
Sequence length 436
Comment pep:known chromosome:MMUL_1:13:42551697:42607884:-1 gene:ENSMMUG00000018583 transcript:ENSMMUT00000026127 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTFGRSGAASVVLNVGGARYSLSRELLKDFPLRRVSRLHGCRSERDVLEVCDDYDRERNE
YFFDRHSEAFGFILLYVRGHGKLRFAPRMCELSFYNEMIYWGLEGAHLEYCCQRRLDDRM
SDTYTFYSADEPGVLGRDEARPGGAEAAPSRRWLERMRRTFEEPTSSLAAQILASVSVVF
VIVSMVVLCASTLPDWRNAAADNRSLDDRSRYSAGPGREPSGIIEAICIGWFTAECIVRF
IVSKNKCEFVKRPLNIIDLLAITPYYISVLMTVFTGENSQLQRAGVTLRVLRMMRIFWVI
KLARHFIGLQTLGLTLKRCYREMVMLLVFICVAMAIFSALSQLLEHGLDLETSNKDFTSI
PAACWWVIISMTTVGYGDMYPITVPGRILGGVCVVSGIVLLALPITFIYHSFVQCYHELK
FRSARYSRSLSAEFLN
Download sequence
Identical sequences A0A096MZR0 A0A2K5KRR7 A0A2K5W0B4 A0A2K6BH76 F6YEM0
ENSMMUP00000024450 ENSMMUP00000024450 XP_005576071.1.63531 XP_011711353.1.29376 XP_011940329.1.92194 XP_014967699.1.72884 9544.ENSMMUP00000024450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]