SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000024608 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000024608
Domain Number 1 Region: 418-474
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.46e-25
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 2 Region: 530-586
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.05e-24
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 3 Region: 2-58
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.27e-24
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 4 Region: 473-530
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.2e-22
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 5 Region: 571-623
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.52e-22
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 6 Region: 251-308
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.39e-17
Family Classic zinc finger, C2H2 0.0099
Further Details:      
 
Domain Number 7 Region: 213-265
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000878
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 8 Region: 295-346
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000521
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 9 Region: 361-418
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000246
Family Classic zinc finger, C2H2 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000024608   Gene: ENSMMUG00000018698   Transcript: ENSMMUT00000026287
Sequence length 628
Comment pep:known_by_projection chromosome:MMUL_1:14:3281768:3294621:-1 gene:ENSMMUG00000018698 transcript:ENSMMUT00000026287 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TLLTFRDVAIEFSLEEWKCLDPAQQNLYRDVMLENYRNLFSIGLTVSKPGLITCLEQRKE
PWNVKRQEAVDGRPEMGFHHATQACLELLGSSDLPASASQSAEITGVNHCAQPALKVSVD
KFTALCSPGVLQTLKWFLEFRCIFSLAMSSHVTQDLLPEQGIQDAFPKSILRGYGNCGLD
NLHLRKDWESLNECKLQKDYNELNQCSSTTHSKIFQCNKYVKIFNNFSNLHRHNISNTGE
KPFKCQECGKSFQMFSFLTEHQKIHTGKKFQKCGECGKTFIQCSHFTEHENIDTGEKPYR
CQECDKVFKTCSVLTKNRIYAGGEHYKCEEFGKVFNQYSHLTEHERGTEEKPCKYEECSS
VFISCSSLSNQQLILAGEKLSKCETWYRGFNHSPNPSKHQRNEIGGKPFKCEECDSIFKW
FSDLTKHKRIHTGEKPYKCEECGKAYTQSSHLSEHRRIHTGEKPYQCEECGKVFRTCSSL
SNHKRTHSEEKPYTCEECGNIFKQLSDLTKHKKTHTGEKPYKCDECGKNFTQSSNLIVHK
RIHTGEKPYKCEECGRVFMWFSDITKHKKTHTGEKPYKCDECGKNFTQSSNLIVHKRIHT
GEKPYKCEKCGKAFTQFSHLTVHESIHT
Download sequence
Identical sequences 9544.ENSMMUP00000024608 ENSMMUP00000037734 ENSMMUP00000024608

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]