SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000024750 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000024750
Domain Number 1 Region: 378-459
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 4.45e-20
Family HLH, helix-loop-helix DNA-binding domain 0.0000926
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000024750   Gene: ENSMMUG00000018805   Transcript: ENSMMUT00000026440
Sequence length 464
Comment pep:known chromosome:MMUL_1:13:15940918:15945978:1 gene:ENSMMUG00000018805 transcript:ENSMMUT00000026440 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSCSASTMPGMICKNPDLEFDSLQPCFYPDEDDFYFGGPDSTPPGEDIWKKFELLPTPP
LSPSRGFAEHSSEPPSWVTEMLLENELWGSPAEEDAFGLGGLGGLTPNPVILQDCMWSGF
SAREKLERAVSEKLQHGRGPPTAGSTAQSPGAGAASPAGRGHGGAAGAGRAGAALPAELA
HPAAECVDPAVVFPFPVNKREPAPMPAAPASAPAVGPAVASGAGVSAPAGAPGVAPPRPG
GRQTNGGDHKALSTSGEDTLSDSDDEDDEEEDEEEEIDVVTVEKRRSSSNTKAVTTFTIT
VRPKNAALGPGRAQSSELILKRCLPIHQQHNYAAPSPYVESEDAPPQKKIKNEVSPRPLK
SVIPPKAKSLSPRNSDSEDSERRRNHNILERQRRNDLRSSFLTLRDHVPELVKNEKAAKV
VILKKATEYVHSLQAEEHQLLLEKEKLQARQQQLLKKIEHARTC
Download sequence
Identical sequences ENSMMUP00000024751 9544.ENSMMUP00000024750 ENSMMUP00000024750

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]