SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000024917 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000024917
Domain Number 1 Region: 103-145
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000106
Family EGF-type module 0.0054
Further Details:      
 
Domain Number 2 Region: 153-186
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000028
Family EGF-type module 0.0083
Further Details:      
 
Domain Number 3 Region: 57-95
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000186
Family EGF-type module 0.01
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000024917
Domain Number - Region: 22-44
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0205
Family EGF-type module 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000024917   Gene: ENSMMUG00000005722   Transcript: ENSMMUT00000026624
Sequence length 228
Comment pep:known chromosome:MMUL_1:19:14087638:14094869:1 gene:ENSMMUG00000005722 transcript:ENSMMUT00000026624 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AFCVWLTLLGAETQDSRDCARWCPENSSCVNATACRCNPGFSSSSEIFTSPTEICDDINE
CVPPSKVSCGKSSDCRNTEGSYDCVCNPGYELVSGAKTFKNESENTCQDVDECQQNPRLC
KSYGTCVNTLGSFTCQCLPGFKFKPEDPKLCTDVNECTSGQNPCHSSTHCLNNVGSYQCR
CRPGWQPIPGSPNGPNNTICEGRELRSHVPRDPQTSNHMFNGTTNQAE
Download sequence
Identical sequences ENSMMUP00000024917

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]