SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000025311 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000025311
Domain Number 1 Region: 1204-1465
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.85e-35
Family Voltage-gated potassium channels 0.017
Further Details:      
 
Domain Number 2 Region: 521-754
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.43e-32
Family Voltage-gated potassium channels 0.016
Further Details:      
 
Domain Number 3 Region: 125-296,343-411
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.53e-32
Family Voltage-gated potassium channels 0.016
Further Details:      
 
Domain Number 4 Region: 883-1038,1078-1156
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.33e-29
Family Voltage-gated potassium channels 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000025311   Gene: ENSMMUG00000019262   Transcript: ENSMMUT00000027055
Sequence length 2156
Comment pep:known chromosome:MMUL_1:2:82530117:82851229:-1 gene:ENSMMUG00000019262 transcript:ENSMMUT00000027055 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMMMMMMKKMQHQRQQQADHANEANYARGTRLPLSGEGPTSQPNSSKQTVLSWQAAIDAA
RQAKAAQTMSTSAPRPVGSLSQRKRQQYAKSKKQGNSSNSRPARALFCLSLNNPIRRACI
SIVEWKPFDIFILLAIFANCVALAIYIPFPEDDSNSTNHNLEKVEYAFLIIFTVETFLKI
IAYGLLLHPNAYVRNGWNLLDFVIVIVGLFSVILEQLTKETEGGNHSSGKSGGFDVKALR
AFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFIGKMHKT
CFFADSDIVAEEDPAPCAFSGNGRQCTANGTECRSGWVGPNGGITNFDNFAFAMLTVFQC
ITMEGWTDVLYWVSTLGREFPMVLKKNTSFFFFLRWNLVLGALSVEFSKEREKAKARGDF
QKLREKQQLEEDLKGYLDWITQAEDIDPENEEEGGEEGKRNTSMPTSETESVNTENVSGE
GETRGCCGSLCQAISKSKLSRRWRRWNRFNRRRCRAAVKSVTFYWLVIVLVFLNTLTISS
EHYNQPDWLTQIQDIANKVLLALFTCEMLVKMYSLGLQAYFVSLFNRFDCFVVCGGITET
ILVELEIMSPLGISVFRCVRLLRIFKVTRHWTSLSNLVASLLNSMKSIASLLLLLFLFII
IFSLLGMQLFGGKFNFDETQTKRSTFDNFPQALLTVFQILTGEDWNAVMYDGIMAYGGPS
SSGMIVCIYFIILFICGNYILLNVFLAIAVDNLADAESLNTAQKEEAEEKERKKIARKES
LENKKNNKPEVNQVANSDNKVTIDDYREEDEDKDPYPPCDVPVGEEEEEEEEDEPEVPAG
PRPRRISELNMKEKIAPIPEGSAFFILSKTNPIRVGCHKLINHHVFTNLILVFIMLSSAA
LAAEDPIRSHSFRNTILGYFDYAFTAIFTVEILLKMTTFGAFLHKGAFCRNYFNLLDMLV
VGVSLVSFGIQSSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIMIVT
TLLQFMFACIGVQLFKGKFYRCTDEAKSNPEECRGLFILYKDGDVDSPVVRERIWQNSDF
NFDNVLSAMMALFTVSTFEGWPALLYKAIDSNGENIGPIYNHRVEISIFFIIYIIIVAFF
MMNIFVGFVIVTFQEQGEKEYKNCELDKNQRQCVEYALKARPLRRYIPKNPYQYKFWYVV
NSSPFEYMMFVLIMLNTLCLAMQHYEQSKMFNDAMDILNMVFTGVFTVEMVLKVIAFKPK
GYFSDAWNTFDSLIVIGSIIDVALSEADPTESENVPVPTATPGNSEESNRISITFFRLFR
VMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIAMLFFIYAVIGMQMFGKVAMRDNNQ
INRNNNFQTFPQAVLLLFRCATGEAWQEIMLACLPGKLCDPESDYNPGEEYTCGSNFAIV
YFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWSEYDPEAKGRIKH
LDVVTLLRRIQPPLGFGKLCPHRVACKVSVLCACPTASLVEARFIQQTLVNSLFPFCFLN
PGNLEQANEELRAVIKKIWKKTSMKLLDQVVPPAGDDEVTVGKFYATFLIQDYFRKFKKR
KEQGLVGKYPAKNTTIALQVNCYTAHSPKCGLAISGPQGKDPTELAEFVFHVEKRNGALL
GNHVNHVNSDRRDSLQQTNTTHRPLHVQRPSIPPASDTEKPLFPPAGNSVCHNHHNHNSI
GKQVPTSTNANLNNANMSKAAHGKRPSIGNLEHVSENGHHSSHKHDREPQRRSSVKRTRY
YETYIRSDSGDEQLPTICREDPEIHGYFRDPRCFGEQEYFSSEECYEDDSSPTWSSRNSR
PEGEWSWRKRTTERQVPFHHPLGALREEMSGQPCPHDSASPTVCMMPFAFPAHRRSSFNF
ECLRRQSSQEEVPSSPTFPHRTALPLHLMQQQIMAVAGLDSSKAQKYSPSHSTRSWATPP
ATPPYRDWTPCYTPLIQVEQSEALDQMNGSLPSLHRSSWYTDEPDISYRTFTPASLTVPS
SFRNKNSDKQRSADSLVEAVLISEGLGRYARDPKFVSATKHEIADACDLTIDEMESAAST
LLNGNVCPRANGDVGPLSHRQDYELQDFGPGYSDEEPDPGRDEEDLADEMICITTL
Download sequence
Identical sequences ENSMMUP00000025311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]