SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000025462 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000025462
Domain Number 1 Region: 487-544
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.54e-26
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 2 Region: 236-292
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.74e-25
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 3 Region: 347-404
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.76e-25
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 4 Region: 179-236
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.37e-24
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 5 Region: 431-488
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.87e-24
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 6 Region: 291-348
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.72e-23
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 7 Region: 529-581
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.69e-22
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 8 Region: 141-193
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.61e-20
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 9 Region: 2-59
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.62e-19
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 10 Region: 394-426
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000163
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000025462   Gene: ENSMMUG00000001436   Transcript: ENSMMUT00000027218
Sequence length 586
Comment pep:known chromosome:MMUL_1:19:59272210:59279052:-1 gene:ENSMMUG00000001436 transcript:ENSMMUT00000027218 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GQLTLKDVAIEFSQEEWTYLDSAQKTLYRDVILENYRNLVSLAGISPFDLSIISLLEQGK
EPWNVDSQEKIAISPSVLHSIKNPYFSVHRDQTYFSYSTLRQFVDVGDKNIQFLKEDRQT
GEGKIYEYNQVEKSLNNRGEKPYQCNECGKAFTVRSNLTIHQVIHAGEKPYKCHECGKVF
SQPSNLAGHRRIHTGEKPYKCNECGKAFRAHSKLTTHQVIHTGEKPYKCKECGKCFTQNS
HLASHRRIHTGEKPYKCNECGKAFSVRSSLTTHQTIHTGEKPYKCNECGKVFRHNSYLAK
HRRIHTGEKPYKCNKCGKAFSMHSNLTKHQIIHTGEKPFKCNECVKVFTQYSHLANHQRI
HTGEKPYRCDECSKAFSVRSSLTTHQAIHTGEKPYKCNDCGKVFTQNSHLASHRGIHSGA
KPYKCGECGKAFSQTSQLARHWRVHTGEKPYKCNECGRAFSVHSSLTIHQTIHTGPKPYK
CNDCGKVFRHSSYLAVHQRIHTGEKPYKCNECGKAFSVHSNLATHQVIHTGEKPYKCNEC
GKVFTQNSHLANHRRIHTGEKPYRCNECGKAFSVRSTLTTHMAIHT
Download sequence
Identical sequences ENSMMUP00000025462

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]