SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000025615 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000025615
Domain Number 1 Region: 1-295,399-439
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.09e-67
Family FAD-linked reductases, N-terminal domain 0.0000000000568
Further Details:      
 
Domain Number 2 Region: 275-385
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 2.09e-36
Family L-aminoacid/polyamine oxidase 0.000000731
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000025615   Gene: ENSMMUG00000019492   Transcript: ENSMMUT00000027387
Sequence length 505
Comment pep:known chromosome:MMUL_1:X:41506924:41584840:-1 gene:ENSMMUG00000019492 transcript:ENSMMUT00000027387 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GMAAAKLLHDSGLNVVVLEARDRVGGRTYTLRNQKVKYVDLGGSYVGPTQNRILRLAKEL
GLETYKVNEVERLIHHVKGKSYPFRGPFPPVWNPITYLDHNNFWRTMDDMGREIPSDAPW
KAPLAEEWDNMTMKELLDKVCWTESAKQLGTLFVNLCVTAETHEVSALWFLWYVKQCGGT
TRIISTTNGGQERKFVGGSGQVSERIMDLLGDRVKLERPVIYIDQTRENVLVQTLNHEMY
EAKYVISAIPPTLGMKIHFNPPLPMMRNQMITRVPLGSVIKCIVYYKEPFWRKKDYCGTM
IIDGEEAPVAYTLDDTKPEGNYAAIMGFILAHKARKLARLTKEERLKKLCELYAKVLGSP
EALEPVHYEEKNWCEEQYSGGCYTTYFPPGILTQYGRVLRQPVDRIYFAGTETATHWSGY
MEGAVEAGERAAREILHAMGKIPEDEVWQSEPESVDVPALPITTTFLERYLPSVPGLLRL
IGLTTIFSATALGFLAHRRGLLMRV
Download sequence
Identical sequences 9544.ENSMMUP00000025615 ENSMMUP00000025615 ENSMMUP00000025615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]