SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000025673 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000025673
Domain Number 1 Region: 404-461
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.96e-26
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 2 Region: 460-517
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.74e-25
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 3 Region: 348-405
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.5e-25
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 4 Region: 292-349
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.33e-24
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 5 Region: 236-293
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6e-24
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 6 Region: 2-59
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.19e-23
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 7 Region: 180-237
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.09e-20
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 8 Region: 502-554
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000624
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 9 Region: 142-194
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000104
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000025673   Gene: ENSMMUG00000019543   Transcript: ENSMMUT00000027450
Sequence length 562
Comment pep:novel chromosome:MMUL_1:19:21743521:21753156:1 gene:ENSMMUG00000019543 transcript:ENSMMUT00000027450 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GVLTFRDVAIEFSLEEWQCLDTAQQNLYRNVMLENYRNLVFLGIAASKPDLITCLEQGKE
PWNVKRHEMGAELPVVCSYFAQDLWPKQGIKNYFQKVILRRYKKYGHENLQLRKYCKSVD
ECKVREECYNGLSQCLTTTQNKIFQCDKYVKVFHKFSNSDRCKIKHTGKKAFKCKECEKS
FCVLSHLAQQERIHTGEKPYKCKECAKAYNEASNLSTHIRIHTGKKPCKCEECGKAFNQL
SHLTTHKIIHTGKKPYKCEECGKAFNQSANLTTHKRIHTGEKPYKCEEYGKAFSQSSTLT
AHKIIHAGEKPYKCEECGKAFTQSSTLTTHKIIHTGEKFYKCEECGKAFSRFSHLTTHKR
IHSGEKPYKCEECGKAFNLSSQLTTHKRIHTGEKPYKCEECGKAFNQSSTLSKHKLIHTG
EKPYKCEECGKAFTQSSYLTTHKRIHTGEKPYKCEECGKAFNRSSTLSKHKVIHTGEKPY
KCEECGKAFNQSSHLTTHKRIHTGEKPYKCEECGKAFNNSSILNRHKMIHTGEKLYKPES
CNNACDYIANISKHKRKCAGEK
Download sequence
Identical sequences 9544.ENSMMUP00000025673 ENSMMUP00000025673 ENSMMUP00000025673

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]