SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000025907 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000025907
Domain Number 1 Region: 95-176
Classification Level Classification E-value
Superfamily Immunoglobulin 5.64e-17
Family I set domains 0.019
Further Details:      
 
Domain Number 2 Region: 2-91
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000155
Family I set domains 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000025907   Gene: ENSMMUG00000019712   Transcript: ENSMMUT00000027697
Sequence length 189
Comment pep:known_by_projection chromosome:MMUL_1:19:48089220:48090562:1 gene:ENSMMUG00000019712 transcript:ENSMMUT00000027697 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ELPKPYITSNNSNPVEDKDAVDFTCEPDIHSTTYLWWVNDQSLPVSPRLQLSNGNRTLTL
LSVKRNDAGAYECEIQNPVSANLSDPVILNVLYGPDVPTISPSNSNYRPGENLNLSCHAA
SNPTAQYSWFVNGTFQQSTQELFIPNITVNNSGSYMCQAYNSATGLNRTTVMMITVSVTN
SSLSVTSLC
Download sequence
Identical sequences ENSMMUP00000025907

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]