SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000025914 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000025914
Domain Number 1 Region: 93-297
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.22e-50
Family DBL homology domain (DH-domain) 0.00000029
Further Details:      
 
Domain Number 2 Region: 284-446
Classification Level Classification E-value
Superfamily PH domain-like 1.38e-32
Family Pleckstrin-homology domain (PH domain) 0.0047
Further Details:      
 
Domain Number 3 Region: 573-674,723-749
Classification Level Classification E-value
Superfamily SH2 domain 2.39e-27
Family SH2 domain 0.00051
Further Details:      
 
Domain Number 4 Region: 495-604
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000163
Family SH3-domain 0.0017
Further Details:      
 
Domain Number 5 Region: 690-738
Classification Level Classification E-value
Superfamily SH3-domain 0.000000019
Family SH3-domain 0.0021
Further Details:      
 
Domain Number 6 Region: 11-131
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0000167
Family Calponin-homology domain, CH-domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000025914   Gene: ENSMMUG00000019714   Transcript: ENSMMUT00000027704
Sequence length 753
Comment pep:known chromosome:MMUL_1:1:110482577:110696011:-1 gene:ENSMMUG00000019714 transcript:ENSMMUT00000027704 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQLRDCPCRAHLPVIETLSRLSRTPIALATGIRPFPTEESINDEDVYKGLPDLIDETLVE
DEEDLYDCVYGEDEGGEVYEDLMKAEEAHQPKCPENDIRSCCLAEIKQTEEKYTETLESI
EKYFMAPLKRFLTAAEFDSVFMNIPELVKLHRNLMQEIHDSIVNKNDHNLYQVFINYKER
LVIYGQYCSGVESAISSLDYISKTKEDVKLKLEECSKRANNGKFTLRDLLVVPMQRVLKY
HLLLQELVKHTADATEKANLKLALDAMKDLAQYVNEVKRDNETLREIKQFQLSIENLNQP
VLLFGRPQGDGEIRITTLDKHTKQERHIFLFDLAVIVCKRKGDNYEMKEIIDLQQYKIAN
NPTTDKENKKWSYGFYLIHTQGQNGLEFYCKTKDLKKKWLEQFEMALSNIRPDYADSNFH
DFKMHTFTRVTSCKVCQMLLRGTFYQGYLCFKCGARAHKECLGRVDNCGRVNSGEQGTLK
LPEKRTNGLRRTPKQVDPGLPKMQVIRNYSGTPPPALHEGPPLHLQAGDTVELLRGDAHS
LFWQGRNLASGEVGFFPSDAVKPCPCVPKPVDYSCQPWYAGAMERLQAETELINRVNSTY
LVRHRTKESGEYAISIKYNNEAKHIKILTRDGFFHIAENRKFKSLMELVEYYKHHSLKEG
FRTLDTTLQFPYKEPEHSTGQRVNRAGNSLLSPKVLGIAIARYDFCARDMRELSLLKGDV
VKIYTKMSANGWWRGEVNGRVGWFPSTYVEEDE
Download sequence
Identical sequences ENSMMUP00000025914

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]