SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000026392 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000026392
Domain Number 1 Region: 460-516
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.36e-25
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 2 Region: 1-58
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 9.81e-24
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 3 Region: 575-628
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.65e-23
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 4 Region: 404-460
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.88e-23
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 5 Region: 516-570
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.31e-23
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 6 Region: 291-348
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.27e-22
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 7 Region: 236-292
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.61e-20
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 8 Region: 348-404
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.1e-19
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 9 Region: 669-721
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.38e-19
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 10 Region: 627-684
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.33e-18
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 11 Region: 200-250
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.99e-18
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000026392   Gene: ENSMMUG00000003712   Transcript: ENSMMUT00000028207
Sequence length 726
Comment pep:known_by_projection chromosome:MMUL_1:19:58051359:58072004:-1 gene:ENSMMUG00000003712 transcript:ENSMMUT00000028207 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QESLTLEDVAVEFSWEEWQLLDTAQKNLYRDVMVENYNHLVSLGYQTSKPDVLSKLAHGQ
EPWITVAKIQNKNCPEIRKIDDPLQHHLQNQSIQKSVKQCHEQNMFGNSVNQNKSHLLLK
QDPDTFDLHEKPLKSNLSFENQKRSSGLKNSAEFNGDGKSLFHANHKQFYTEMKFPAIAK
PINKSQVIKQQRTHDIENAHVCSECGKAFLKLSQFIDHQRVHTGEKPHVCSICGKAFSRK
SRLMDHQRTHTGLKHYECECDKTFLKKSQLNIHQKTHMGEKPYTCSECGKAFIKKCRLIY
HQRTHTGEKPHGCSVCGKAFSTKFSLTTHQKTHTGEKPYICSECGKGFIEKRRLTAHHRT
HTGEKPFICDKCGKGFTLKNSLITHQQTHTEKKLYTCGECGKGFSMKHCLMVHQRTHTGE
KPYKCNECGKGFALKSPLIRHQRTHTGEKPYVCTECRKGFTMKSDLIVHQRTHTAEKPYT
CNDCGKGFTVKSRLIVHQRTHTGEKPYICGECGKGFPAKIRLMGHQRTHTGEKPYICNEC
GKGFTEKSHLNVHRRTHTGEKPYVCSECGKGLTGKSMLIAHQRTHTGEKPYICNECGKGF
TMKSTLGIHQQTHTGEKPYKCNECDKTFRKKTCLIQHQRFHTGKTSFACTECGKFSLRKN
DLITHQRIHTGEKPYKCSDCEKAFTTKSGLNVHQRKHTGERPYGCSDCGKAFAHLSILVK
HKRIHR
Download sequence
Identical sequences ENSMMUP00000026392

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]