SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000026546 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000026546
Domain Number 1 Region: 392-449
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.2e-26
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 2 Region: 448-505
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.51e-25
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 3 Region: 560-617
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.69e-25
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 4 Region: 280-337
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.73e-24
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 5 Region: 336-393
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.39e-24
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 6 Region: 504-561
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4e-24
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 7 Region: 224-281
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.79e-24
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 8 Region: 168-225
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.69e-23
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 9 Region: 3-50
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 7.06e-20
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 10 Region: 108-169
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000157
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000026546   Gene: ENSMMUG00000003688   Transcript: ENSMMUT00000028366
Sequence length 618
Comment pep:known_by_projection chromosome:MMUL_1:19:22395068:22408754:-1 gene:ENSMMUG00000003688 transcript:ENSMMUT00000028366 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VCVFQGLLTFRDVAIEFSLEEWQRLDAAQQNLYRNVMLENYRNLAFLGKFSFCIMSEMRE
SSQENLQFFIFSSFFKRVSFLLHYQQIWCFQKIDSDHLSECEWQKYEKCGHENLQLRKSC
KSVDECKKIHTEDKPYKCEECGKAFNNSQPLLHINLSTHKIIHTGEKSYNHSSTLAKHKR
IHTGEKPYKCKECGKAFSNSSTLTNHKITHTEEKPYKCKECGKAFKRLSTLTKHKIIHAG
EKLYKCEECGKAFNRSSNLTAHKIIHTGEKPYKCEECGKAFIWSSSLTKHKRIHTREKLF
KCKECDKAFIWSSTLTRHKRIHTGEKPYKCEECGKAFNHSSTLTKHKTIHTGEKPYKCKE
CGKAFVWSSTLTEHKRIHTREKPYKCEECGKAFSQPSHLTTHKRMHTGEKPYKCEECGKA
FSQSSTLTTHKIIHTGEKPYKCEECGKAFRKSSTLTEHKIIHTGEKPYKCEECGKAFSQS
STLTRHKRMHTGEKPYKCEECGKAFNRSSKLTTHKIIHTGEKPYKCEECGKAFISSSTLT
GHKRIHTREKPYKCEECGKAFSQSSTLTRHKRMHTGEKPYKCEECGKAFKESSALTKHKI
IHTGEKPYKCEKCGKAFN
Download sequence
Identical sequences ENSMMUP00000026546

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]